BLASTX nr result
ID: Coptis24_contig00025593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025593 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517890.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 ref|XP_002889473.1| predicted protein [Arabidopsis lyrata subsp.... 72 6e-11 ref|XP_003540924.1| PREDICTED: putative DNA repair and recombina... 71 8e-11 ref|XP_004154596.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA... 69 4e-10 ref|XP_004140040.1| PREDICTED: putative DNA repair and recombina... 69 4e-10 >ref|XP_002517890.1| conserved hypothetical protein [Ricinus communis] gi|223542872|gb|EEF44408.1| conserved hypothetical protein [Ricinus communis] Length = 870 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -2 Query: 131 FQFDPKGPFEPLLLSSPGVIPIVQVPAAINCRLLEHQRGGVKF 3 FQFD GPFEPLLLS PG +PIVQVPA+INCRLLEHQR GVKF Sbjct: 113 FQFDHTGPFEPLLLSLPGEVPIVQVPASINCRLLEHQREGVKF 155 >ref|XP_002889473.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297335315|gb|EFH65732.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 876 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -2 Query: 128 QFDPKGPFEPLLLSSPGVIPIVQVPAAINCRLLEHQRGGVKF 3 +FD GP+EPLLLSS G IPI+QVPA+INCRLLEHQR GVKF Sbjct: 109 EFDYSGPYEPLLLSSMGEIPIIQVPASINCRLLEHQREGVKF 150 >ref|XP_003540924.1| PREDICTED: putative DNA repair and recombination protein RAD26-like [Glycine max] Length = 870 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -2 Query: 131 FQFDPKGPFEPLLLSSPGVIPIVQVPAAINCRLLEHQRGGVKF 3 FQFD GPFEPLLLSS G P VQVPA+INCRLLEHQR GV+F Sbjct: 99 FQFDHTGPFEPLLLSSHGEFPPVQVPASINCRLLEHQREGVRF 141 >ref|XP_004154596.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA repair and recombination protein RAD26-like [Cucumis sativus] Length = 840 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 131 FQFDPKGPFEPLLLSSPGVIPIVQVPAAINCRLLEHQRGGVKF 3 FQFD GPFEPL+LSS P+VQVP +INCRLLEHQR GVKF Sbjct: 77 FQFDHTGPFEPLILSSKDDFPLVQVPPSINCRLLEHQREGVKF 119 >ref|XP_004140040.1| PREDICTED: putative DNA repair and recombination protein RAD26-like [Cucumis sativus] Length = 880 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 131 FQFDPKGPFEPLLLSSPGVIPIVQVPAAINCRLLEHQRGGVKF 3 FQFD GPFEPL+LSS P+VQVP +INCRLLEHQR GVKF Sbjct: 117 FQFDHTGPFEPLILSSKDDFPLVQVPPSINCRLLEHQREGVKF 159