BLASTX nr result
ID: Coptis24_contig00025564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025564 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_181224.1| xyloglucan:xyloglucosyl transferase [Arabidopsi... 71 8e-11 ref|XP_002881475.1| hypothetical protein ARALYDRAFT_482667 [Arab... 71 8e-11 ref|XP_002323501.1| predicted protein [Populus trichocarpa] gi|2... 69 5e-10 gb|ACD03222.1| xyloglucan endotransglucosylase/hydrolase 12 [Act... 68 9e-10 ref|XP_002519471.1| Xyloglucan endotransglucosylase/hydrolase pr... 66 3e-09 >ref|NP_181224.1| xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] gi|38605514|sp|Q9SJL9.1|XTH32_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase protein 32; Short=At-XTH32; Short=XTH-32; Flags: Precursor gi|4883603|gb|AAD31572.1| xyloglucan endotransglycosylase, putative [Arabidopsis thaliana] gi|15027967|gb|AAK76514.1| putative xyloglucan endo-transglycosylase [Arabidopsis thaliana] gi|21595304|gb|AAM66089.1| putative xyloglucan endo-transglycosylase [Arabidopsis thaliana] gi|22136872|gb|AAM91780.1| putative xyloglucan endo-transglycosylase [Arabidopsis thaliana] gi|330254214|gb|AEC09308.1| xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] Length = 299 Score = 71.2 bits (173), Expect = 8e-11 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -3 Query: 399 SKQQYAAMRWAQTHYLVYNYCRDYKRDHSVTPECWK 292 ++QQ+ AMRW QTH +VYNYC+DYKRDHS+TPECW+ Sbjct: 264 TRQQHQAMRWVQTHSMVYNYCKDYKRDHSLTPECWR 299 >ref|XP_002881475.1| hypothetical protein ARALYDRAFT_482667 [Arabidopsis lyrata subsp. lyrata] gi|297327314|gb|EFH57734.1| hypothetical protein ARALYDRAFT_482667 [Arabidopsis lyrata subsp. lyrata] Length = 299 Score = 71.2 bits (173), Expect = 8e-11 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -3 Query: 399 SKQQYAAMRWAQTHYLVYNYCRDYKRDHSVTPECWK 292 ++QQ+ AMRW QTH +VYNYC+DYKRDHS+TPECW+ Sbjct: 264 TRQQHQAMRWVQTHSMVYNYCKDYKRDHSLTPECWR 299 >ref|XP_002323501.1| predicted protein [Populus trichocarpa] gi|222868131|gb|EEF05262.1| predicted protein [Populus trichocarpa] Length = 294 Score = 68.6 bits (166), Expect = 5e-10 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = -3 Query: 399 SKQQYAAMRWAQTHYLVYNYCRDYKRDHSVTPECW 295 ++QQY +MRW Q H++VY+YC+DYKRDHS+TPECW Sbjct: 259 TRQQYRSMRWVQRHHMVYDYCKDYKRDHSLTPECW 293 >gb|ACD03222.1| xyloglucan endotransglucosylase/hydrolase 12 [Actinidia eriantha] Length = 294 Score = 67.8 bits (164), Expect = 9e-10 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 399 SKQQYAAMRWAQTHYLVYNYCRDYKRDHSVTPECW 295 S +QY AMRW Q+H+LVY+YCRD KRDHS+TPECW Sbjct: 259 STRQYMAMRWVQSHFLVYDYCRDSKRDHSLTPECW 293 >ref|XP_002519471.1| Xyloglucan endotransglucosylase/hydrolase protein 14 precursor, putative [Ricinus communis] gi|223541334|gb|EEF42885.1| Xyloglucan endotransglucosylase/hydrolase protein 14 precursor, putative [Ricinus communis] Length = 296 Score = 66.2 bits (160), Expect = 3e-09 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 399 SKQQYAAMRWAQTHYLVYNYCRDYKRDHSVTPECW 295 ++QQY AMRW QT ++VYNYC D KRDHS+TPECW Sbjct: 259 TRQQYRAMRWVQTRHMVYNYCMDSKRDHSLTPECW 293