BLASTX nr result
ID: Coptis24_contig00025554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025554 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537260.1| PREDICTED: interactor of constitutive active... 91 1e-16 ref|XP_003542499.1| PREDICTED: interactor of constitutive active... 84 2e-14 emb|CAC84774.1| P70 protein [Nicotiana tabacum] 83 2e-14 emb|CBI32691.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_002279291.1| PREDICTED: interactor of constitutive active... 81 1e-13 >ref|XP_003537260.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] Length = 626 Score = 90.9 bits (224), Expect = 1e-16 Identities = 50/84 (59%), Positives = 60/84 (71%), Gaps = 6/84 (7%) Frame = +3 Query: 219 MQTPKSRSGTLEVPKRSSPMTAQNARQLKMTGLEFD------PPVGRTLKERSPKVIVRR 380 MQTPK+R+GT EVP+R SP + QNAR+LK G + D P +T K RSPKV R+ Sbjct: 1 MQTPKARTGTSEVPQRKSPASPQNARKLKTPGSDTDSVSSSPKPGSKTPKNRSPKVTERK 60 Query: 381 SPRSPVSEVQKKRPGRMSELESQL 452 SPRSP+SE KKRPGR+ ELESQL Sbjct: 61 SPRSPISE--KKRPGRVQELESQL 82 >ref|XP_003542499.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] Length = 624 Score = 83.6 bits (205), Expect = 2e-14 Identities = 46/84 (54%), Positives = 58/84 (69%), Gaps = 6/84 (7%) Frame = +3 Query: 219 MQTPKSRSGTLEVPKRSSPMTAQNARQLKMTGLEFD------PPVGRTLKERSPKVIVRR 380 MQTPK+R+GT EVP+R SP + QNAR+LK G + D P +T K +SPKV R+ Sbjct: 1 MQTPKARTGTSEVPQRKSPASPQNARKLKTPGSDTDSVSSSPKPGSKTPKNKSPKVTERK 60 Query: 381 SPRSPVSEVQKKRPGRMSELESQL 452 SPRSP+SE KK+P R+ E ESQL Sbjct: 61 SPRSPISE--KKQPSRVQESESQL 82 >emb|CAC84774.1| P70 protein [Nicotiana tabacum] Length = 601 Score = 83.2 bits (204), Expect = 2e-14 Identities = 44/83 (53%), Positives = 61/83 (73%), Gaps = 5/83 (6%) Frame = +3 Query: 219 MQTPKSRSGTLEVPKRSSPMTAQNARQLKMTGLEFDP-----PVGRTLKERSPKVIVRRS 383 MQTPK+R+ ++EVP+R+SP T + R+LK G + D P RT K+RSPKV+ RRS Sbjct: 1 MQTPKARTVSVEVPQRTSPATPKTTRKLKTPGSDADSVSSPNPATRTPKDRSPKVVGRRS 60 Query: 384 PRSPVSEVQKKRPGRMSELESQL 452 PRSPV ++KKRP ++S+LE+QL Sbjct: 61 PRSPV--IEKKRPSKVSDLEAQL 81 >emb|CBI32691.3| unnamed protein product [Vitis vinifera] Length = 508 Score = 80.9 bits (198), Expect = 1e-13 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 5/83 (6%) Frame = +3 Query: 219 MQTPKSRSGTLEVPKRSSPMTAQNARQLKMTGLEFDP-----PVGRTLKERSPKVIVRRS 383 MQTPK R+G+LEVP R+SP T + AR+LK G + D P RT K+RSPK++ +S Sbjct: 1 MQTPKRRTGSLEVPPRTSPATPRTARKLKTPGSDGDSVSSPHPASRTPKDRSPKIV--KS 58 Query: 384 PRSPVSEVQKKRPGRMSELESQL 452 RSPVSE KKRP ++SELESQ+ Sbjct: 59 TRSPVSE--KKRPSKLSELESQV 79 >ref|XP_002279291.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vitis vinifera] Length = 621 Score = 80.9 bits (198), Expect = 1e-13 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 5/83 (6%) Frame = +3 Query: 219 MQTPKSRSGTLEVPKRSSPMTAQNARQLKMTGLEFDP-----PVGRTLKERSPKVIVRRS 383 MQTPK R+G+LEVP R+SP T + AR+LK G + D P RT K+RSPK++ +S Sbjct: 1 MQTPKRRTGSLEVPPRTSPATPRTARKLKTPGSDGDSVSSPHPASRTPKDRSPKIV--KS 58 Query: 384 PRSPVSEVQKKRPGRMSELESQL 452 RSPVSE KKRP ++SELESQ+ Sbjct: 59 TRSPVSE--KKRPSKLSELESQV 79