BLASTX nr result
ID: Coptis24_contig00025489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025489 (174 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26947.3| unnamed protein product [Vitis vinifera] 79 5e-13 ref|XP_002280156.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 emb|CAN69810.1| hypothetical protein VITISV_043106 [Vitis vinifera] 79 5e-13 ref|XP_004159312.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 78 6e-13 ref|XP_004135384.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 78 6e-13 >emb|CBI26947.3| unnamed protein product [Vitis vinifera] Length = 1078 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = -2 Query: 173 MLRDKNLVRQAREVYKVMGECGIRPTIVTYNTLLDMFCKEGEIHEALHLFSEMQERG 3 +LRDK+L+ +A EVY+ MGE GI+PTIVTYNTLLD +CK G++ + L L SEMQ RG Sbjct: 208 ILRDKDLMSKAVEVYRTMGEFGIKPTIVTYNTLLDSYCKGGKVQQGLDLLSEMQRRG 264 >ref|XP_002280156.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Vitis vinifera] Length = 718 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = -2 Query: 173 MLRDKNLVRQAREVYKVMGECGIRPTIVTYNTLLDMFCKEGEIHEALHLFSEMQERG 3 +LRDK+L+ +A EVY+ MGE GI+PTIVTYNTLLD +CK G++ + L L SEMQ RG Sbjct: 208 ILRDKDLMSKAVEVYRTMGEFGIKPTIVTYNTLLDSYCKGGKVQQGLDLLSEMQRRG 264 >emb|CAN69810.1| hypothetical protein VITISV_043106 [Vitis vinifera] Length = 847 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = -2 Query: 173 MLRDKNLVRQAREVYKVMGECGIRPTIVTYNTLLDMFCKEGEIHEALHLFSEMQERG 3 +LRDK+L+ +A EVY+ MGE GI+PTIVTYNTLLD +CK G++ + L L SEMQ RG Sbjct: 514 ILRDKDLMSKAVEVYRTMGEFGIKPTIVTYNTLLDSYCKGGKVQQGLDLLSEMQRRG 570 >ref|XP_004159312.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Cucumis sativus] Length = 772 Score = 78.2 bits (191), Expect = 6e-13 Identities = 34/57 (59%), Positives = 47/57 (82%) Frame = -2 Query: 173 MLRDKNLVRQAREVYKVMGECGIRPTIVTYNTLLDMFCKEGEIHEALHLFSEMQERG 3 +LRD+NL+ +A+ VY +M + GI+PT+VTYNT+LD +CKEG + +AL L SEMQERG Sbjct: 189 VLRDENLLSKAKNVYGMMEQFGIKPTVVTYNTMLDSYCKEGRVDQALELLSEMQERG 245 >ref|XP_004135384.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Cucumis sativus] Length = 717 Score = 78.2 bits (191), Expect = 6e-13 Identities = 34/57 (59%), Positives = 47/57 (82%) Frame = -2 Query: 173 MLRDKNLVRQAREVYKVMGECGIRPTIVTYNTLLDMFCKEGEIHEALHLFSEMQERG 3 +LRD+NL+ +A+ VY +M + GI+PT+VTYNT+LD +CKEG + +AL L SEMQERG Sbjct: 189 VLRDENLLSKAKNVYGMMEQFGIKPTVVTYNTMLDSYCKEGRVDQALELLSEMQERG 245