BLASTX nr result
ID: Coptis24_contig00025326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025326 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63610.1| hypothetical protein VITISV_000282 [Vitis vinifera] 57 2e-06 ref|XP_002279964.1| PREDICTED: uncharacterized protein LOC100255... 56 3e-06 >emb|CAN63610.1| hypothetical protein VITISV_000282 [Vitis vinifera] Length = 1138 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 1 HILKPNPHTDQDNSKLLHSTIPFGSMITSAKVSNLQKKTSKIYRF 135 HILKP+ + D D+S+ HSTIPF ++ S +VS QKKT+KIYRF Sbjct: 1094 HILKPSQNMDHDSSRPTHSTIPFAAVTDSGRVSGPQKKTAKIYRF 1138 >ref|XP_002279964.1| PREDICTED: uncharacterized protein LOC100255858 [Vitis vinifera] Length = 1000 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 1 HILKPNPHTDQDNSKLLHSTIPFGSMITSAKVSNLQKKTSKIYRF 135 HILKP+ + D D+S+ HSTIPF ++ S +VS QKKT+KIYRF Sbjct: 956 HILKPSQNMDHDSSRPTHSTIPFAAVTDSDRVSGPQKKTAKIYRF 1000