BLASTX nr result
ID: Coptis24_contig00025178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025178 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631282.1| PREDICTED: putative pentatricopeptide repeat... 59 4e-07 ref|XP_003530680.1| PREDICTED: putative pentatricopeptide repeat... 59 4e-07 >ref|XP_003631282.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405-like [Vitis vinifera] Length = 615 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/57 (45%), Positives = 43/57 (75%) Frame = -2 Query: 173 ISSIKYIGMHPTITLLQTCKTLKQIKQIHNQLIINGHCNDHYAHLINQFISTVALKH 3 +SS++ I HPTI++++ C TL+++KQIH QL+ING ND L+ QF++++AL + Sbjct: 1 MSSLRCIVKHPTISMVEPCTTLRELKQIHTQLLINGLLND--PQLVGQFVASIALNN 55 >ref|XP_003530680.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405-like [Glycine max] Length = 616 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/55 (49%), Positives = 40/55 (72%) Frame = -2 Query: 173 ISSIKYIGMHPTITLLQTCKTLKQIKQIHNQLIINGHCNDHYAHLINQFISTVAL 9 + S+K I HPTI+LL +C TLK++KQIH QL++ G N+ + H QF++T+AL Sbjct: 1 MKSVKRIAKHPTISLLNSCTTLKEMKQIHAQLVVKGILNNPHFH--GQFVATIAL 53