BLASTX nr result
ID: Coptis24_contig00025145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025145 (443 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB10876.1| polyprotein [Arabidopsis thaliana] 60 2e-07 emb|CAN72257.1| hypothetical protein VITISV_034188 [Vitis vinifera] 55 5e-06 >dbj|BAB10876.1| polyprotein [Arabidopsis thaliana] Length = 1429 Score = 59.7 bits (143), Expect = 2e-07 Identities = 23/48 (47%), Positives = 36/48 (75%) Frame = -2 Query: 292 PWIAGTGATNHVTPHLSNLNNYFDYVGGEKISVGNGQGLPITHTGQLL 149 PW+ +GAT+H+T L+NL+ + Y GGE++++ +G GLPI+HTG L Sbjct: 313 PWVLDSGATHHLTSDLANLSMHQPYTGGEEVTIADGSGLPISHTGSAL 360 >emb|CAN72257.1| hypothetical protein VITISV_034188 [Vitis vinifera] Length = 1259 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = -2 Query: 289 WIAGTGATNHVTPHLSNLNNYFDYVGGEKISVGNGQGLPITHTGQL 152 W+ +GA++HVT LSNL+ + Y G + I +G+G GLPITHTG L Sbjct: 369 WLLDSGASHHVTSDLSNLSIHAPYNGSDDIMIGDGTGLPITHTGSL 414