BLASTX nr result
ID: Coptis24_contig00025043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025043 (542 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147836.1| PREDICTED: auxin response factor 5-like [Cuc... 55 5e-06 >ref|XP_004147836.1| PREDICTED: auxin response factor 5-like [Cucumis sativus] gi|449476870|ref|XP_004154860.1| PREDICTED: auxin response factor 5-like [Cucumis sativus] Length = 949 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 541 DDSWEEFVTCVRSIRILSPSEVQQMSDDGL 452 DD WEEFV+CVR IRILSPSEVQQMS++G+ Sbjct: 899 DDPWEEFVSCVRCIRILSPSEVQQMSEEGM 928