BLASTX nr result
ID: Coptis24_contig00025041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025041 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37064.3| unnamed protein product [Vitis vinifera] 87 1e-15 ref|XP_002274039.1| PREDICTED: probable calcium-activated outwar... 87 1e-15 emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] 87 1e-15 ref|XP_002515189.1| Calcium-activated outward-rectifying potassi... 82 5e-14 ref|XP_002317301.1| outward rectifying potassium channel [Populu... 80 1e-13 >emb|CBI37064.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 87.4 bits (215), Expect = 1e-15 Identities = 42/63 (66%), Positives = 52/63 (82%) Frame = -2 Query: 239 VSENTAIWLRHNSSICKSDYVIYKLKEMGKISEKDILQIGSQFNKLDPSNSGRITLPDLL 60 V + A + +N I KS+YVIYKLKEMGKI+E D+LQI +QFNKLDP+NSG+ITLPDLL Sbjct: 152 VEDLLAADINNNGFISKSEYVIYKLKEMGKIAENDVLQICNQFNKLDPNNSGKITLPDLL 211 Query: 59 ESH 51 E+H Sbjct: 212 ENH 214 >ref|XP_002274039.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 5, chloroplastic [Vitis vinifera] Length = 390 Score = 87.4 bits (215), Expect = 1e-15 Identities = 42/63 (66%), Positives = 52/63 (82%) Frame = -2 Query: 239 VSENTAIWLRHNSSICKSDYVIYKLKEMGKISEKDILQIGSQFNKLDPSNSGRITLPDLL 60 V + A + +N I KS+YVIYKLKEMGKI+E D+LQI +QFNKLDP+NSG+ITLPDLL Sbjct: 327 VEDLLAADINNNGFISKSEYVIYKLKEMGKIAENDVLQICNQFNKLDPNNSGKITLPDLL 386 Query: 59 ESH 51 E+H Sbjct: 387 ENH 389 >emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] Length = 390 Score = 87.4 bits (215), Expect = 1e-15 Identities = 42/63 (66%), Positives = 52/63 (82%) Frame = -2 Query: 239 VSENTAIWLRHNSSICKSDYVIYKLKEMGKISEKDILQIGSQFNKLDPSNSGRITLPDLL 60 V + A + +N I KS+YVIYKLKEMGKI+E D+LQI +QFNKLDP+NSG+ITLPDLL Sbjct: 327 VEDLLAADINNNGFISKSEYVIYKLKEMGKIAENDVLQICNQFNKLDPNNSGKITLPDLL 386 Query: 59 ESH 51 E+H Sbjct: 387 ENH 389 >ref|XP_002515189.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223545669|gb|EEF47173.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 390 Score = 82.0 bits (201), Expect = 5e-14 Identities = 41/62 (66%), Positives = 50/62 (80%) Frame = -2 Query: 239 VSENTAIWLRHNSSICKSDYVIYKLKEMGKISEKDILQIGSQFNKLDPSNSGRITLPDLL 60 V + A + +N I KS+YVIYKLKEMGKI EKDILQI +QF+KLDP+N G+ITLPDLL Sbjct: 327 VEDLIAADINNNGFISKSEYVIYKLKEMGKIGEKDILQICNQFSKLDPNNLGKITLPDLL 386 Query: 59 ES 54 E+ Sbjct: 387 EN 388 >ref|XP_002317301.1| outward rectifying potassium channel [Populus trichocarpa] gi|222860366|gb|EEE97913.1| outward rectifying potassium channel [Populus trichocarpa] Length = 428 Score = 80.5 bits (197), Expect = 1e-13 Identities = 41/63 (65%), Positives = 48/63 (76%) Frame = -2 Query: 239 VSENTAIWLRHNSSICKSDYVIYKLKEMGKISEKDILQIGSQFNKLDPSNSGRITLPDLL 60 VSE A + +N + KS+YVIYKLKEMGKISEKDILQI QF +LD N G+ITL DL+ Sbjct: 365 VSEFLAADIDNNGFVSKSEYVIYKLKEMGKISEKDILQICQQFERLDTGNCGKITLADLM 424 Query: 59 ESH 51 ESH Sbjct: 425 ESH 427