BLASTX nr result
ID: Coptis24_contig00024996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00024996 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containi... 72 5e-11 ref|XP_002524769.1| pentatricopeptide repeat-containing protein,... 60 2e-07 >ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] gi|296086664|emb|CBI32299.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 72.0 bits (175), Expect = 5e-11 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = -2 Query: 217 LSNEVAQLCDELVSNQFDSKKVFGILEDKVVSLIRIYSNGAAFVSLLEKLKPWPLLFIKV 38 L +V+QL DELV + DS V +LE+K SL R YSNG+AFV LL++L WP L ++V Sbjct: 62 LRGKVSQLRDELVPSGDDSDMVVRVLEEKGESLFRSYSNGSAFVELLKQLSSWPYLALQV 121 Query: 37 FNWRREKCE 11 FNWRR + + Sbjct: 122 FNWRRNQTD 130 >ref|XP_002524769.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535953|gb|EEF37612.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 509 Score = 59.7 bits (143), Expect = 2e-07 Identities = 42/117 (35%), Positives = 63/117 (53%), Gaps = 1/117 (0%) Frame = -2 Query: 358 KLISLFTEKEIDAYRKLISLFTEK-ETNGRIIHKTNRQRFIHKTEDVFLSNEVAQLCDEL 182 KL T + + + +ISLF+ + + + I ED LS V+ L DEL Sbjct: 43 KLARAHTSEPVSFFPNIISLFSRRFPVDNKAI------------ED--LSKTVSHLRDEL 88 Query: 181 VSNQFDSKKVFGILEDKVVSLIRIYSNGAAFVSLLEKLKPWPLLFIKVFNWRREKCE 11 V + DS K F +LE++ SL R+ S+ +A V LL +L P L ++VFNWRR++ E Sbjct: 89 VQHAEDSDKFFRVLEEQGDSLFRMRSDRSALVELLRQLVSLPHLAVEVFNWRRKQTE 145