BLASTX nr result
ID: Coptis24_contig00024912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00024912 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003890463.1| hypothetical protein PGTG_20919 [Puccinia gr... 83 3e-14 ref|XP_003888486.1| hypothetical protein PGTG_22748 [Puccinia gr... 81 8e-14 ref|XP_003889171.1| hypothetical protein PGTG_22135 [Puccinia gr... 80 2e-13 ref|XP_003888890.1| hypothetical protein PGTG_22372 [Puccinia gr... 80 2e-13 ref|XP_003890800.1| hypothetical protein PGTG_20606 [Puccinia gr... 80 2e-13 >ref|XP_003890463.1| hypothetical protein PGTG_20919 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|403169823|ref|XP_003889586.1| hypothetical protein PGTG_21659 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375168436|gb|EHS63650.1| hypothetical protein PGTG_21659 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375171215|gb|EHS64307.1| hypothetical protein PGTG_20919 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 326 Score = 82.8 bits (203), Expect = 3e-14 Identities = 43/109 (39%), Positives = 61/109 (55%), Gaps = 1/109 (0%) Frame = -2 Query: 324 EDGDGNLMATPVNNQKRKSVHFTMLEDQALCNAWVKNSEDAVNGKCQTSGGFWNRVVVDF 145 + + N A P N K+K+ ++T ED LC AWV+ SED G Q G FW R+ + Sbjct: 31 DQNNDNDNANPENEGKKKAPNYTEPEDYELCRAWVQVSEDPAVGTNQDGGTFWQRISTVY 90 Query: 144 HQRLPNVERSIDSLTGRW-KHIKKHVTKFTAIMNQVENQRPSGASIEDQ 1 H+ +P R + SL RW +++ + KF I++QVE SGAS EDQ Sbjct: 91 HEAVPRPIRPVTSLKKRWSNNVQPPINKFRGIVHQVEALNQSGASTEDQ 139 >ref|XP_003888486.1| hypothetical protein PGTG_22748 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375165823|gb|EHS62993.1| hypothetical protein PGTG_22748 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 326 Score = 81.3 bits (199), Expect = 8e-14 Identities = 42/109 (38%), Positives = 61/109 (55%), Gaps = 1/109 (0%) Frame = -2 Query: 324 EDGDGNLMATPVNNQKRKSVHFTMLEDQALCNAWVKNSEDAVNGKCQTSGGFWNRVVVDF 145 + + N A P N K+K+ ++T ED LC AWV+ SED G Q G FW R+ + Sbjct: 31 DQNNDNDNANPENEGKKKAPNYTEPEDYELCRAWVQVSEDPAVGTNQDGGTFWQRISTVY 90 Query: 144 HQRLPNVERSIDSLTGRW-KHIKKHVTKFTAIMNQVENQRPSGASIEDQ 1 H+ +P R + SL RW +++ + KF I++QVE SGAS +DQ Sbjct: 91 HEAVPRPIRPVTSLKKRWSNNVQPPINKFRGIVHQVEALNQSGASTKDQ 139 >ref|XP_003889171.1| hypothetical protein PGTG_22135 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375170777|gb|EHS64212.1| hypothetical protein PGTG_22135 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 314 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/98 (38%), Positives = 54/98 (55%) Frame = -2 Query: 294 PVNNQKRKSVHFTMLEDQALCNAWVKNSEDAVNGKCQTSGGFWNRVVVDFHQRLPNVERS 115 P +K+K+ ++T ED LC AW++ SED G Q FW RV +H+ +P R Sbjct: 25 PTATKKKKAPNYTEPEDFELCRAWIRISEDPAVGTHQDGNTFWQRVTTAYHEAIPTPIRP 84 Query: 114 IDSLTGRWKHIKKHVTKFTAIMNQVENQRPSGASIEDQ 1 IDS RW +++ + KF A ++Q E SG S EDQ Sbjct: 85 IDSTKKRWGILQRWINKFRACVDQAEQMNQSGQSAEDQ 122 >ref|XP_003888890.1| hypothetical protein PGTG_22372 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375172224|gb|EHS64583.1| hypothetical protein PGTG_22372 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 310 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/97 (40%), Positives = 61/97 (62%), Gaps = 1/97 (1%) Frame = -2 Query: 288 NNQKRKSVHFTMLEDQALCNAWVKNSEDAVNGKCQTSGGFWNRVVVDFHQRLPNVERSID 109 N +K+K+ ++T LED +C AWV+ S+D + G Q FW+RV +H+ +P+ R +D Sbjct: 24 NAKKKKAPNYTELEDFEVCRAWVQVSKDPMVGTNQDGNTFWSRVSTLYHEAVPDPIRPVD 83 Query: 108 SLTGRW-KHIKKHVTKFTAIMNQVENQRPSGASIEDQ 1 SL RW +++ + KF +N VE++ SGAS EDQ Sbjct: 84 SLKKRWSNYLQPSINKFRGFVNIVESRNESGASAEDQ 120 >ref|XP_003890800.1| hypothetical protein PGTG_20606 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375163642|gb|EHS62483.1| hypothetical protein PGTG_20606 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 310 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/97 (40%), Positives = 60/97 (61%), Gaps = 1/97 (1%) Frame = -2 Query: 288 NNQKRKSVHFTMLEDQALCNAWVKNSEDAVNGKCQTSGGFWNRVVVDFHQRLPNVERSID 109 N +K+K+ ++T ED +C AWV+ SED + G Q FW+RV +H+ +P+ R +D Sbjct: 24 NTKKKKAPNYTEPEDFEVCRAWVQVSEDPMVGTNQDGNTFWSRVSTLYHEAVPDPIRPVD 83 Query: 108 SLTGRW-KHIKKHVTKFTAIMNQVENQRPSGASIEDQ 1 SL RW +++ + KF +N VE++ SGAS EDQ Sbjct: 84 SLKKRWSNYLQPSINKFRGFVNLVESRNESGASAEDQ 120