BLASTX nr result
ID: Coptis24_contig00024715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00024715 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326941.1| predicted protein [Populus trichocarpa] gi|2... 118 6e-25 ref|XP_002302436.1| predicted protein [Populus trichocarpa] gi|2... 116 2e-24 ref|NP_001233874.1| protein DCL, chloroplastic [Solanum lycopers... 115 3e-24 ref|XP_004141259.1| PREDICTED: protein DCL, chloroplastic-like [... 114 8e-24 ref|NP_683398.1| uncharacterized protein [Arabidopsis thaliana] ... 110 1e-22 >ref|XP_002326941.1| predicted protein [Populus trichocarpa] gi|222835256|gb|EEE73691.1| predicted protein [Populus trichocarpa] Length = 209 Score = 118 bits (295), Expect = 6e-25 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = +1 Query: 1 GVDYIKVDFHPDFVDSRCLFVVRKDGESVDFSYWKCIKGLIKKNYPLYADSFILRHFQRR 180 G+DYI V +HPDFV+SRCLF+VRKDG+ VDFSYWKCIKGLIKKNYPLYADSFILRHF+RR Sbjct: 147 GIDYITVGYHPDFVESRCLFIVRKDGQLVDFSYWKCIKGLIKKNYPLYADSFILRHFRRR 206 >ref|XP_002302436.1| predicted protein [Populus trichocarpa] gi|222844162|gb|EEE81709.1| predicted protein [Populus trichocarpa] Length = 212 Score = 116 bits (291), Expect = 2e-24 Identities = 49/59 (83%), Positives = 56/59 (94%) Frame = +1 Query: 1 GVDYIKVDFHPDFVDSRCLFVVRKDGESVDFSYWKCIKGLIKKNYPLYADSFILRHFQR 177 G+DYI V +HPDF DSRCLF+VRKDG++VDFSYWKC+KGLIKKNYPLYADSFILRHF+R Sbjct: 154 GIDYITVGYHPDFADSRCLFIVRKDGQAVDFSYWKCLKGLIKKNYPLYADSFILRHFRR 212 >ref|NP_001233874.1| protein DCL, chloroplastic [Solanum lycopersicum] gi|6014934|sp|Q42463.1|DCL_SOLLC RecName: Full=Protein DCL, chloroplastic; AltName: Full=Defective chloroplasts and leaves protein; Flags: Precursor gi|1305531|gb|AAC49433.1| defective chloroplasts and leaves; required for chloroplast development and palisade cell differentiation in leaves [Solanum lycopersicum] gi|1323698|gb|AAC49434.1| DCL [Solanum lycopersicum] Length = 224 Score = 115 bits (289), Expect = 3e-24 Identities = 50/60 (83%), Positives = 57/60 (95%) Frame = +1 Query: 1 GVDYIKVDFHPDFVDSRCLFVVRKDGESVDFSYWKCIKGLIKKNYPLYADSFILRHFQRR 180 GVDYI V +HPDF +SRCLF+VRKDGE+VDFSYWKCIKGLI+KNYPLYADSFILRHF++R Sbjct: 161 GVDYITVGYHPDFENSRCLFIVRKDGETVDFSYWKCIKGLIRKNYPLYADSFILRHFRKR 220 >ref|XP_004141259.1| PREDICTED: protein DCL, chloroplastic-like [Cucumis sativus] gi|449519344|ref|XP_004166695.1| PREDICTED: protein DCL, chloroplastic-like [Cucumis sativus] Length = 225 Score = 114 bits (285), Expect = 8e-24 Identities = 50/60 (83%), Positives = 55/60 (91%) Frame = +1 Query: 1 GVDYIKVDFHPDFVDSRCLFVVRKDGESVDFSYWKCIKGLIKKNYPLYADSFILRHFQRR 180 GVDYI V +HPDF SRCLF+VRKDGE VDFSYWKCIKGLI+KNYPLYA+SFILRHF+RR Sbjct: 160 GVDYITVGYHPDFESSRCLFIVRKDGEMVDFSYWKCIKGLIRKNYPLYAESFILRHFRRR 219 >ref|NP_683398.1| uncharacterized protein [Arabidopsis thaliana] gi|12321014|gb|AAG50632.1|AC083835_17 defective chloroplasts and leaves (DCL) protein, putative [Arabidopsis thaliana] gi|22135799|gb|AAM91086.1| At1g45261/F2G19.1 [Arabidopsis thaliana] gi|48310651|gb|AAT41860.1| At1g45261 [Arabidopsis thaliana] gi|62318604|dbj|BAD95026.1| defective chloroplasts and leaves (DCL) protein [Arabidopsis thaliana] gi|332193992|gb|AEE32113.1| uncharacterized protein [Arabidopsis thaliana] Length = 219 Score = 110 bits (275), Expect = 1e-22 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = +1 Query: 1 GVDYIKVDFHPDFVDSRCLFVVRKDGESVDFSYWKCIKGLIKKNYPLYADSFILRHFQRR 180 G+DYI V HPDF SRC+F+VRKDGE VDFSYWKCIKGLIKK YPLYADSFILRHF++R Sbjct: 156 GIDYIMVGHHPDFESSRCMFIVRKDGEVVDFSYWKCIKGLIKKKYPLYADSFILRHFRKR 215