BLASTX nr result
ID: Coptis24_contig00024638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00024638 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267721.2| PREDICTED: conserved oligomeric Golgi comple... 96 5e-25 emb|CBI38713.3| unnamed protein product [Vitis vinifera] 96 5e-25 ref|XP_003520884.1| PREDICTED: conserved oligomeric Golgi comple... 91 1e-23 emb|CAB80949.1| hypothetical protein [Arabidopsis thaliana] 90 1e-23 ref|NP_192049.4| uncharacterized protein [Arabidopsis thaliana] ... 90 1e-23 >ref|XP_002267721.2| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Vitis vinifera] Length = 1105 Score = 95.9 bits (237), Expect(2) = 5e-25 Identities = 48/56 (85%), Positives = 51/56 (91%), Gaps = 1/56 (1%) Frame = -3 Query: 165 GDMNNSFKQLLNAGME-LVTTVTPRIRPVLDSVGIISYELSEAEYAENEVNDPWVQ 1 G+M+N FKQ LNAGME LV TVTPRIRPVLDSVG ISYELSEAEYA+NEVNDPWVQ Sbjct: 915 GEMSNIFKQTLNAGMEQLVATVTPRIRPVLDSVGTISYELSEAEYADNEVNDPWVQ 970 Score = 43.5 bits (101), Expect(2) = 5e-25 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -2 Query: 241 HEIEEQCVEAFPAPAGGEMVKSCLS 167 HEIEEQC E FP PA E VKSCLS Sbjct: 888 HEIEEQCAEVFPTPADREKVKSCLS 912 >emb|CBI38713.3| unnamed protein product [Vitis vinifera] Length = 707 Score = 95.9 bits (237), Expect(2) = 5e-25 Identities = 48/56 (85%), Positives = 51/56 (91%), Gaps = 1/56 (1%) Frame = -3 Query: 165 GDMNNSFKQLLNAGME-LVTTVTPRIRPVLDSVGIISYELSEAEYAENEVNDPWVQ 1 G+M+N FKQ LNAGME LV TVTPRIRPVLDSVG ISYELSEAEYA+NEVNDPWVQ Sbjct: 517 GEMSNIFKQTLNAGMEQLVATVTPRIRPVLDSVGTISYELSEAEYADNEVNDPWVQ 572 Score = 43.5 bits (101), Expect(2) = 5e-25 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -2 Query: 241 HEIEEQCVEAFPAPAGGEMVKSCLS 167 HEIEEQC E FP PA E VKSCLS Sbjct: 490 HEIEEQCAEVFPTPADREKVKSCLS 514 >ref|XP_003520884.1| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Glycine max] Length = 1114 Score = 90.9 bits (224), Expect(2) = 1e-23 Identities = 44/55 (80%), Positives = 50/55 (90%), Gaps = 1/55 (1%) Frame = -3 Query: 162 DMNNSFKQLLNAGME-LVTTVTPRIRPVLDSVGIISYELSEAEYAENEVNDPWVQ 1 D +N+FKQ LNAG+E LV T+TPRIRP+LDSVG ISYELSEAEYA+NEVNDPWVQ Sbjct: 925 DSSNAFKQALNAGIEQLVATITPRIRPLLDSVGTISYELSEAEYADNEVNDPWVQ 979 Score = 43.9 bits (102), Expect(2) = 1e-23 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -2 Query: 241 HEIEEQCVEAFPAPAGGEMVKSCLS 167 HEIEEQC E FPAPA E VKSCL+ Sbjct: 897 HEIEEQCAEVFPAPADREKVKSCLT 921 >emb|CAB80949.1| hypothetical protein [Arabidopsis thaliana] Length = 1117 Score = 89.7 bits (221), Expect(2) = 1e-23 Identities = 43/56 (76%), Positives = 51/56 (91%), Gaps = 1/56 (1%) Frame = -3 Query: 165 GDMNNSFKQLLNAGME-LVTTVTPRIRPVLDSVGIISYELSEAEYAENEVNDPWVQ 1 G+++++FKQLLN+GME LV TVTPRIRPVLD+V ISYEL+E EYAENEVNDPWVQ Sbjct: 927 GELSSTFKQLLNSGMEQLVATVTPRIRPVLDTVATISYELTETEYAENEVNDPWVQ 982 Score = 44.7 bits (104), Expect(2) = 1e-23 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -2 Query: 241 HEIEEQCVEAFPAPAGGEMVKSCLS 167 HEIEEQC E FPAPA E +KSCLS Sbjct: 900 HEIEEQCTEVFPAPADRERIKSCLS 924 >ref|NP_192049.4| uncharacterized protein [Arabidopsis thaliana] gi|332656619|gb|AEE82019.1| uncharacterized protein [Arabidopsis thaliana] Length = 1110 Score = 89.7 bits (221), Expect(2) = 1e-23 Identities = 43/56 (76%), Positives = 51/56 (91%), Gaps = 1/56 (1%) Frame = -3 Query: 165 GDMNNSFKQLLNAGME-LVTTVTPRIRPVLDSVGIISYELSEAEYAENEVNDPWVQ 1 G+++++FKQLLN+GME LV TVTPRIRPVLD+V ISYEL+E EYAENEVNDPWVQ Sbjct: 920 GELSSTFKQLLNSGMEQLVATVTPRIRPVLDTVATISYELTETEYAENEVNDPWVQ 975 Score = 44.7 bits (104), Expect(2) = 1e-23 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -2 Query: 241 HEIEEQCVEAFPAPAGGEMVKSCLS 167 HEIEEQC E FPAPA E +KSCLS Sbjct: 893 HEIEEQCTEVFPAPADRERIKSCLS 917