BLASTX nr result
ID: Coptis24_contig00024100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00024100 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516555.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_004136217.1| PREDICTED: U-box domain-containing protein 2... 55 6e-06 >ref|XP_002516555.1| conserved hypothetical protein [Ricinus communis] gi|223544375|gb|EEF45896.1| conserved hypothetical protein [Ricinus communis] Length = 373 Score = 57.0 bits (136), Expect = 2e-06 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 3/65 (4%) Frame = -1 Query: 223 FTQWRFPIPESPSLH--CLPQ-QPESTSNIPKPPIPSMTLTELFHVAEIQLSAESYNSRL 53 FTQW+FP+ SP LH PQ +P+ST +P PPI S L E+FH AE+QLS S + +L Sbjct: 92 FTQWKFPLVTSP-LHPESDPQTKPDSTIPLP-PPINSTKLQEVFHAAELQLSGGSEHEKL 149 Query: 52 SSVHL 38 +S+HL Sbjct: 150 ASLHL 154 >ref|XP_004136217.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus] gi|449534015|ref|XP_004173965.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus] Length = 324 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/69 (44%), Positives = 41/69 (59%), Gaps = 7/69 (10%) Frame = -1 Query: 223 FTQWRFPIPESPSLHCLP--QQPESTSNIP-----KPPIPSMTLTELFHVAEIQLSAESY 65 FTQWRFP+P SP P P ST +IP PPI + L E+ VAE+QLS+ S Sbjct: 70 FTQWRFPLPHSPIFTQQPSISDPPSTFSIPPPDPLPPPISASALKEILQVAELQLSSASD 129 Query: 64 NSRLSSVHL 38 + RL+++ L Sbjct: 130 SDRLAALQL 138