BLASTX nr result
ID: Coptis24_contig00023917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023917 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEI84807.1| bHLH transcription factor [Malus x domestica] 73 3e-11 gb|ADL36597.1| BHLH domain class transcription factor [Malus x d... 73 3e-11 dbj|BAM36702.1| bHLH transcriptional factor AN1 homolog [Rosa hy... 72 4e-11 gb|AFL02463.1| transcription factor bHLH3 [Fragaria x ananassa] 70 1e-10 ref|XP_002277508.1| PREDICTED: transcription factor TT8 [Vitis v... 67 1e-09 >gb|AEI84807.1| bHLH transcription factor [Malus x domestica] Length = 709 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = -3 Query: 172 MVQAVAEPSELMQIEMSEDIRLGSPDDGS-NLDSEMHMLGLSQSMNHTNLQHRVDS 8 ++ AVAEPSELMQ+EMSEDIRLGSPDD S NLDS+ H+L +SQS N + Q + DS Sbjct: 286 VLAAVAEPSELMQLEMSEDIRLGSPDDASNNLDSDFHLLAVSQSRNPADQQRQADS 341 >gb|ADL36597.1| BHLH domain class transcription factor [Malus x domestica] Length = 709 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = -3 Query: 172 MVQAVAEPSELMQIEMSEDIRLGSPDDGS-NLDSEMHMLGLSQSMNHTNLQHRVDS 8 ++ AVAEPSELMQ+EMSEDIRLGSPDD S NLDS+ H+L +SQS N + Q + DS Sbjct: 286 VLAAVAEPSELMQLEMSEDIRLGSPDDASNNLDSDFHLLAVSQSRNPADQQRQADS 341 >dbj|BAM36702.1| bHLH transcriptional factor AN1 homolog [Rosa hybrid cultivar] Length = 702 Score = 72.4 bits (176), Expect = 4e-11 Identities = 37/51 (72%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -3 Query: 157 AEPSELMQIEMSEDIRLGSPDDGS-NLDSEMHMLGLSQSMNHTNLQHRVDS 8 AEPSELMQ+EMSEDIRLGSPDD S NLDS+ HML +SQS N N Q + DS Sbjct: 292 AEPSELMQLEMSEDIRLGSPDDASNNLDSDFHMLAVSQSANAANQQRQTDS 342 >gb|AFL02463.1| transcription factor bHLH3 [Fragaria x ananassa] Length = 697 Score = 70.5 bits (171), Expect = 1e-10 Identities = 36/51 (70%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -3 Query: 157 AEPSELMQIEMSEDIRLGSPDDGS-NLDSEMHMLGLSQSMNHTNLQHRVDS 8 AEPSELMQ+EMSEDIRLGSPDD S NLDS+ HML +SQS N + Q + DS Sbjct: 286 AEPSELMQLEMSEDIRLGSPDDASNNLDSDFHMLAVSQSANAADQQRQADS 336 >ref|XP_002277508.1| PREDICTED: transcription factor TT8 [Vitis vinifera] Length = 696 Score = 67.4 bits (163), Expect = 1e-09 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = -3 Query: 184 QNVAMVQAVAEPSELMQIEMSEDIRLGSPDDGS-NLDSEMHMLGLSQSMNHTNLQHRVDS 8 + VA AEPSEL+Q+EMSE IRLGSPDDGS NLDS+ HML +SQ + + Q R DS Sbjct: 285 EGVAGSHTAAEPSELIQLEMSEGIRLGSPDDGSNNLDSDFHMLAVSQPGSSVDHQRRADS 344