BLASTX nr result
ID: Coptis24_contig00023492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023492 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591498.1| Pectinesterase [Medicago truncatula] gi|3554... 167 1e-39 ref|XP_003591484.1| Pectinesterase [Medicago truncatula] gi|3574... 167 1e-39 ref|XP_003591482.1| Pectinesterase [Medicago truncatula] gi|3574... 167 1e-39 ref|XP_002330223.1| predicted protein [Populus trichocarpa] gi|2... 166 1e-39 ref|XP_002523112.1| Pectinesterase-2 precursor, putative [Ricinu... 166 2e-39 >ref|XP_003591498.1| Pectinesterase [Medicago truncatula] gi|355480546|gb|AES61749.1| Pectinesterase [Medicago truncatula] Length = 335 Score = 167 bits (422), Expect = 1e-39 Identities = 79/87 (90%), Positives = 82/87 (94%) Frame = +2 Query: 8 KGQAVALRSGADMSTFYRCSFEGYQDTLYSHSLRQFYRECDIYGTVDFIFGNAAVVLQNC 187 K QAVALRSGADMSTFY CSFEGYQDTLY+HSLRQFYRECDIYGTVDFIFGN AVVLQNC Sbjct: 127 KHQAVALRSGADMSTFYSCSFEGYQDTLYTHSLRQFYRECDIYGTVDFIFGNGAVVLQNC 186 Query: 188 NIYVRLPLSYQFNAVTAQGRTDPNQNT 268 NIY RLPLS QFN++TAQGRTDPNQNT Sbjct: 187 NIYPRLPLSGQFNSITAQGRTDPNQNT 213 >ref|XP_003591484.1| Pectinesterase [Medicago truncatula] gi|357442455|ref|XP_003591505.1| Pectinesterase [Medicago truncatula] gi|355480532|gb|AES61735.1| Pectinesterase [Medicago truncatula] gi|355480553|gb|AES61756.1| Pectinesterase [Medicago truncatula] Length = 315 Score = 167 bits (422), Expect = 1e-39 Identities = 79/87 (90%), Positives = 82/87 (94%) Frame = +2 Query: 8 KGQAVALRSGADMSTFYRCSFEGYQDTLYSHSLRQFYRECDIYGTVDFIFGNAAVVLQNC 187 K QAVALRSGADMSTFY CSFEGYQDTLY+HSLRQFYRECDIYGTVDFIFGN AVVLQNC Sbjct: 107 KHQAVALRSGADMSTFYSCSFEGYQDTLYTHSLRQFYRECDIYGTVDFIFGNGAVVLQNC 166 Query: 188 NIYVRLPLSYQFNAVTAQGRTDPNQNT 268 NIY RLPLS QFN++TAQGRTDPNQNT Sbjct: 167 NIYPRLPLSGQFNSITAQGRTDPNQNT 193 >ref|XP_003591482.1| Pectinesterase [Medicago truncatula] gi|357442459|ref|XP_003591507.1| Pectinesterase [Medicago truncatula] gi|355480530|gb|AES61733.1| Pectinesterase [Medicago truncatula] gi|355480555|gb|AES61758.1| Pectinesterase [Medicago truncatula] Length = 556 Score = 167 bits (422), Expect = 1e-39 Identities = 79/87 (90%), Positives = 82/87 (94%) Frame = +2 Query: 8 KGQAVALRSGADMSTFYRCSFEGYQDTLYSHSLRQFYRECDIYGTVDFIFGNAAVVLQNC 187 K QAVALRSGADMSTFY CSFEGYQDTLY+HSLRQFYRECDIYGTVDFIFGN AVVLQNC Sbjct: 348 KHQAVALRSGADMSTFYSCSFEGYQDTLYTHSLRQFYRECDIYGTVDFIFGNGAVVLQNC 407 Query: 188 NIYVRLPLSYQFNAVTAQGRTDPNQNT 268 NIY RLPLS QFN++TAQGRTDPNQNT Sbjct: 408 NIYPRLPLSGQFNSITAQGRTDPNQNT 434 >ref|XP_002330223.1| predicted protein [Populus trichocarpa] gi|222871679|gb|EEF08810.1| predicted protein [Populus trichocarpa] Length = 567 Score = 166 bits (421), Expect = 1e-39 Identities = 77/89 (86%), Positives = 84/89 (94%) Frame = +2 Query: 2 AIKGQAVALRSGADMSTFYRCSFEGYQDTLYSHSLRQFYRECDIYGTVDFIFGNAAVVLQ 181 AIK QAVA+RSGADMSTFY+CSFEGYQDTLY+HSLRQFYR+CDIYGT+D+IFGNAAVVLQ Sbjct: 357 AIKHQAVAVRSGADMSTFYKCSFEGYQDTLYTHSLRQFYRDCDIYGTIDYIFGNAAVVLQ 416 Query: 182 NCNIYVRLPLSYQFNAVTAQGRTDPNQNT 268 NCNIY RLPL QFN +TAQGRTDPNQNT Sbjct: 417 NCNIYSRLPLDNQFNTLTAQGRTDPNQNT 445 >ref|XP_002523112.1| Pectinesterase-2 precursor, putative [Ricinus communis] gi|223537674|gb|EEF39297.1| Pectinesterase-2 precursor, putative [Ricinus communis] Length = 566 Score = 166 bits (420), Expect = 2e-39 Identities = 78/89 (87%), Positives = 83/89 (93%) Frame = +2 Query: 2 AIKGQAVALRSGADMSTFYRCSFEGYQDTLYSHSLRQFYRECDIYGTVDFIFGNAAVVLQ 181 AIK QAVALRSGAD+STFY CSFEGYQDTLY+HSLRQFY ECDIYGTVDFIFGNAAVV Q Sbjct: 356 AIKHQAVALRSGADLSTFYSCSFEGYQDTLYTHSLRQFYSECDIYGTVDFIFGNAAVVFQ 415 Query: 182 NCNIYVRLPLSYQFNAVTAQGRTDPNQNT 268 NCN+Y RLP+S QFNA+TAQGRTDPNQNT Sbjct: 416 NCNLYPRLPMSGQFNAITAQGRTDPNQNT 444