BLASTX nr result
ID: Coptis24_contig00023460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023460 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK38034.1| unknown [Lotus japonicus] 65 6e-09 ref|NP_001237497.1| uncharacterized protein LOC100306098 [Glycin... 65 7e-09 ref|NP_001238044.1| uncharacterized protein LOC100499667 [Glycin... 65 7e-09 gb|ABK23892.1| unknown [Picea sitchensis] 64 1e-08 emb|CBI28035.3| unnamed protein product [Vitis vinifera] 62 6e-08 >gb|AFK38034.1| unknown [Lotus japonicus] Length = 206 Score = 65.1 bits (157), Expect = 6e-09 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = +3 Query: 51 RDPSSDQIFVFFPDEPKKIGVKIMKACFARMSSENVFRAILVSQKALTP 197 +D SDQI+VFFPDEPK +GVK MK RM+SENVFRAILV Q LTP Sbjct: 61 KDGPSDQIYVFFPDEPK-VGVKTMKTYTNRMNSENVFRAILVCQSNLTP 108 >ref|NP_001237497.1| uncharacterized protein LOC100306098 [Glycine max] gi|255627545|gb|ACU14117.1| unknown [Glycine max] Length = 206 Score = 64.7 bits (156), Expect = 7e-09 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = +3 Query: 51 RDPSSDQIFVFFPDEPKKIGVKIMKACFARMSSENVFRAILVSQKALTP 197 +D S DQI+VFFPDEPK +GVK MK RM+SENV+RAILV+Q LTP Sbjct: 61 KDNSGDQIYVFFPDEPK-VGVKTMKTYTNRMNSENVYRAILVTQTNLTP 108 >ref|NP_001238044.1| uncharacterized protein LOC100499667 [Glycine max] gi|255625665|gb|ACU13177.1| unknown [Glycine max] Length = 206 Score = 64.7 bits (156), Expect = 7e-09 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = +3 Query: 51 RDPSSDQIFVFFPDEPKKIGVKIMKACFARMSSENVFRAILVSQKALTP 197 +D S DQI+VFFPDEPK +GVK MK RM+SENV+RAILV+Q LTP Sbjct: 61 KDNSGDQIYVFFPDEPK-VGVKTMKTYTNRMNSENVYRAILVTQTNLTP 108 >gb|ABK23892.1| unknown [Picea sitchensis] Length = 191 Score = 63.9 bits (154), Expect = 1e-08 Identities = 38/66 (57%), Positives = 44/66 (66%), Gaps = 2/66 (3%) Frame = +3 Query: 18 DPAKEDY--EDRLRDPSSDQIFVFFPDEPKKIGVKIMKACFARMSSENVFRAILVSQKAL 191 DP KED R+ S+QIFVFFP+E K +GVK +K RM SE VFRAILV Q+AL Sbjct: 47 DPKKEDLVINKAKRNSPSEQIFVFFPEEAK-VGVKSIKTYVERMKSEGVFRAILVVQQAL 105 Query: 192 TPPANQ 209 TP A Q Sbjct: 106 TPFARQ 111 >emb|CBI28035.3| unnamed protein product [Vitis vinifera] Length = 186 Score = 61.6 bits (148), Expect = 6e-08 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +3 Query: 51 RDPSSDQIFVFFPDEPKKIGVKIMKACFARMSSENVFRAILVSQKALTP 197 R SSDQI+VFFP+E +K+GVK MK RM SENVFRAILV Q+ LTP Sbjct: 41 RTDSSDQIYVFFPEE-QKVGVKTMKTYTNRMKSENVFRAILVVQQNLTP 88