BLASTX nr result
ID: Coptis24_contig00023399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023399 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163791.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 75 4e-12 ref|XP_004139692.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 75 4e-12 ref|XP_002527090.1| dead box ATP-dependent RNA helicase, putativ... 73 2e-11 ref|XP_003637181.1| DEAD-box ATP-dependent RNA helicase [Medicag... 73 3e-11 emb|CBI29363.3| unnamed protein product [Vitis vinifera] 72 5e-11 >ref|XP_004163791.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 39-like [Cucumis sativus] Length = 634 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -3 Query: 139 STRRIGSCPQVLEPSLSKGNRVMVFCNTLNSSRAVDHYLGENQIST 2 S ++ + QVLEPSL+KGNRVMVFCNTLNSSRAVDH+LGENQIST Sbjct: 360 SENKLEALLQVLEPSLAKGNRVMVFCNTLNSSRAVDHFLGENQIST 405 >ref|XP_004139692.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 39-like [Cucumis sativus] Length = 634 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -3 Query: 139 STRRIGSCPQVLEPSLSKGNRVMVFCNTLNSSRAVDHYLGENQIST 2 S ++ + QVLEPSL+KGNRVMVFCNTLNSSRAVDH+LGENQIST Sbjct: 360 SENKLEALLQVLEPSLAKGNRVMVFCNTLNSSRAVDHFLGENQIST 405 >ref|XP_002527090.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223533513|gb|EEF35253.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Length = 601 Score = 73.2 bits (178), Expect = 2e-11 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 139 STRRIGSCPQVLEPSLSKGNRVMVFCNTLNSSRAVDHYLGENQIST 2 S ++ + QVLEPSL+KGNRVMVFCNTLNSSRAVDH+L ENQIST Sbjct: 361 SENKLEALLQVLEPSLAKGNRVMVFCNTLNSSRAVDHFLAENQIST 406 >ref|XP_003637181.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi|355503116|gb|AES84319.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] Length = 684 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 130 RIGSCPQVLEPSLSKGNRVMVFCNTLNSSRAVDHYLGENQIST 2 ++ S QVLEPSL+KGNRVMVFCNTLNSSRAVDH+L ENQIST Sbjct: 352 KLDSLLQVLEPSLAKGNRVMVFCNTLNSSRAVDHFLEENQIST 394 >emb|CBI29363.3| unnamed protein product [Vitis vinifera] Length = 505 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -3 Query: 139 STRRIGSCPQVLEPSLSKGNRVMVFCNTLNSSRAVDHYLGENQIST 2 S ++ + QVLEPSL+KGN+VMVFCNTLNSSRAVDH+LGENQI T Sbjct: 229 SENKLEALLQVLEPSLAKGNKVMVFCNTLNSSRAVDHFLGENQIFT 274