BLASTX nr result
ID: Coptis24_contig00023374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023374 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADZ24712.1| anthranilate phosphoribosyltransferase [Solanum p... 89 3e-16 ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransf... 88 8e-16 gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidops... 86 4e-15 ref|XP_002871793.1| hypothetical protein ARALYDRAFT_909800 [Arab... 86 4e-15 ref|NP_197300.1| anthranilate phosphoribosyltransferase [Arabido... 86 4e-15 >gb|ADZ24712.1| anthranilate phosphoribosyltransferase [Solanum pennellii] Length = 365 Score = 89.4 bits (220), Expect = 3e-16 Identities = 49/81 (60%), Positives = 52/81 (64%) Frame = +2 Query: 2 LLRAKGETFEEIVGLARAMIKKCRKIEXXXXXXXXXXXXXXXANTVNISTGXXXXXXXXX 181 LLRAKGETFEE+VGLARAMIK CR++E ANTVNISTG Sbjct: 102 LLRAKGETFEEVVGLARAMIKHCRQVEGLGDAVDIVGTGGDGANTVNISTGASILAAACG 161 Query: 182 XXXXKQGNRSSSSACGSADVL 244 KQGNRSSSSACGSADVL Sbjct: 162 AKVAKQGNRSSSSACGSADVL 182 >ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic [Vitis vinifera] gi|296087637|emb|CBI34893.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 87.8 bits (216), Expect = 8e-16 Identities = 49/81 (60%), Positives = 51/81 (62%) Frame = +2 Query: 2 LLRAKGETFEEIVGLARAMIKKCRKIEXXXXXXXXXXXXXXXANTVNISTGXXXXXXXXX 181 LLRAKGETFEE+VGLARAMIK C K+E ANTVNISTG Sbjct: 104 LLRAKGETFEEVVGLARAMIKCCSKVEGVYDAVDIVGTGGDGANTVNISTGAAILAAACG 163 Query: 182 XXXXKQGNRSSSSACGSADVL 244 KQGNRSSSSACGSADVL Sbjct: 164 AKVAKQGNRSSSSACGSADVL 184 >gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana] gi|28394222|gb|AAO42464.1| phosphorybosyl anthranilate transferase 1 [Arabidopsis thaliana] Length = 441 Score = 85.5 bits (210), Expect = 4e-15 Identities = 48/81 (59%), Positives = 51/81 (62%) Frame = +2 Query: 2 LLRAKGETFEEIVGLARAMIKKCRKIEXXXXXXXXXXXXXXXANTVNISTGXXXXXXXXX 181 LLRAKGET+EEIVGLARAM+K RK+E ANTVNISTG Sbjct: 145 LLRAKGETYEEIVGLARAMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACG 204 Query: 182 XXXXKQGNRSSSSACGSADVL 244 KQGNRSSSSACGSADVL Sbjct: 205 AKVAKQGNRSSSSACGSADVL 225 >ref|XP_002871793.1| hypothetical protein ARALYDRAFT_909800 [Arabidopsis lyrata subsp. lyrata] gi|297317630|gb|EFH48052.1| hypothetical protein ARALYDRAFT_909800 [Arabidopsis lyrata subsp. lyrata] Length = 444 Score = 85.5 bits (210), Expect = 4e-15 Identities = 48/81 (59%), Positives = 51/81 (62%) Frame = +2 Query: 2 LLRAKGETFEEIVGLARAMIKKCRKIEXXXXXXXXXXXXXXXANTVNISTGXXXXXXXXX 181 LLRAKGET+EEIVGLARAM+K RK+E ANTVNISTG Sbjct: 148 LLRAKGETYEEIVGLARAMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACG 207 Query: 182 XXXXKQGNRSSSSACGSADVL 244 KQGNRSSSSACGSADVL Sbjct: 208 AKVAKQGNRSSSSACGSADVL 228 >ref|NP_197300.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana] gi|401213|sp|Q02166.1|TRPD_ARATH RecName: Full=Anthranilate phosphoribosyltransferase, chloroplastic; Flags: Precursor gi|166792|gb|AAA32835.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana] gi|9757891|dbj|BAB08398.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|15450852|gb|AAK96697.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|20259900|gb|AAM13297.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|332005110|gb|AED92493.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana] gi|445600|prf||1909347A phosphoribosylanthranilate transferase Length = 444 Score = 85.5 bits (210), Expect = 4e-15 Identities = 48/81 (59%), Positives = 51/81 (62%) Frame = +2 Query: 2 LLRAKGETFEEIVGLARAMIKKCRKIEXXXXXXXXXXXXXXXANTVNISTGXXXXXXXXX 181 LLRAKGET+EEIVGLARAM+K RK+E ANTVNISTG Sbjct: 148 LLRAKGETYEEIVGLARAMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACG 207 Query: 182 XXXXKQGNRSSSSACGSADVL 244 KQGNRSSSSACGSADVL Sbjct: 208 AKVAKQGNRSSSSACGSADVL 228