BLASTX nr result
ID: Coptis24_contig00023315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023315 (1065 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF01072.1| hypothetical protein [Arabidopsis thaliana] 60 4e-07 >dbj|BAF01072.1| hypothetical protein [Arabidopsis thaliana] Length = 224 Score = 60.5 bits (145), Expect(2) = 4e-07 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 3/105 (2%) Frame = +1 Query: 379 LIFIVPFWVQIFGLPLERFNYEDVKSASREVGSFMELDRNGITVLNSPAARVQVILNIRE 558 LI +PFW+QI G+P E + R +G+ ME+D T RVQV NI + Sbjct: 77 LINFIPFWIQIRGIPYHYLTREVIAHVGRALGNLMEVDFGLETAARVDYVRVQVNWNIED 136 Query: 559 QLVKETILEFDNKIRIPVKFKYERLPFFCVIIG---HEMKNCSVK 684 L + +F+ + ++F++ERL FC + G H+ C ++ Sbjct: 137 PLRFQRNFQFEANVNTLLRFRFERLRGFCEVCGMLTHDSGACLIQ 181 Score = 20.8 bits (42), Expect(2) = 4e-07 Identities = 5/18 (27%), Positives = 10/18 (55%) Frame = +2 Query: 311 LNNGPWEVKNHVFSVKRW 364 + GPW + + ++RW Sbjct: 53 MRRGPWAFNDRMLILQRW 70