BLASTX nr result
ID: Coptis24_contig00022944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022944 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147834.1| PREDICTED: auxin-induced protein 6B-like [Cu... 56 3e-06 ref|XP_003549458.1| PREDICTED: auxin-induced protein 6B-like [Gl... 55 6e-06 >ref|XP_004147834.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus] gi|449519840|ref|XP_004166942.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus] Length = 150 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 357 QRYCHVGLRTNLDFWPESRPLLLHGLTENTIW 262 Q YCH+G+RT LD WPESRP LLHGL E +IW Sbjct: 120 QSYCHIGIRTGLDLWPESRP-LLHGLAEKSIW 150 >ref|XP_003549458.1| PREDICTED: auxin-induced protein 6B-like [Glycine max] Length = 151 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 357 QRYCHVGLRTNLDFWPESRPLLLHGLTENTIW 262 + YCHVG+ NLDFWPESRP LLHG T+ TIW Sbjct: 121 RHYCHVGISNNLDFWPESRP-LLHGPTDKTIW 151