BLASTX nr result
ID: Coptis24_contig00022932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022932 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310520.1| predicted protein [Populus trichocarpa] gi|2... 84 9e-15 emb|CBI38165.3| unnamed protein product [Vitis vinifera] 75 4e-12 ref|XP_002264325.1| PREDICTED: pentatricopeptide repeat-containi... 75 4e-12 ref|XP_003602631.1| Pentatricopeptide repeat-containing protein ... 73 3e-11 ref|XP_003540710.1| PREDICTED: pentatricopeptide repeat-containi... 72 4e-11 >ref|XP_002310520.1| predicted protein [Populus trichocarpa] gi|222853423|gb|EEE90970.1| predicted protein [Populus trichocarpa] Length = 710 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/70 (55%), Positives = 51/70 (72%) Frame = +3 Query: 3 RRGVVKQPGRSWIEINNQVHVFMVKDKTHPQRKEVYKLLNILAAQMKRTRYVLDVGHPES 182 RRGVVKQPG SWI+I + VHVFMVKDK HPQ+KE+Y +L +L M++ YV D E+ Sbjct: 627 RRGVVKQPGCSWIDIQSNVHVFMVKDKRHPQKKEIYSILKLLTKHMRQAGYVPDASDHEA 686 Query: 183 KTYKEPMEMD 212 Y+EP E++ Sbjct: 687 --YEEPSELE 694 >emb|CBI38165.3| unnamed protein product [Vitis vinifera] Length = 654 Score = 75.5 bits (184), Expect = 4e-12 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = +3 Query: 3 RRGVVKQPGRSWIEINNQVHVFMVKDKTHPQRKEVYKLLNILAAQMKRTRYVLDVGHPES 182 ++GV KQPG SWIE+ ++VHVF+VKDK+HP RK++Y +L +L QMKR Y+ D E+ Sbjct: 587 QQGVTKQPGCSWIEVESRVHVFLVKDKSHPHRKQIYSVLKMLTEQMKRVGYIPDANDFEA 646 >ref|XP_002264325.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Vitis vinifera] Length = 684 Score = 75.5 bits (184), Expect = 4e-12 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = +3 Query: 3 RRGVVKQPGRSWIEINNQVHVFMVKDKTHPQRKEVYKLLNILAAQMKRTRYVLDVGHPES 182 ++GV KQPG SWIE+ ++VHVF+VKDK+HP RK++Y +L +L QMKR Y+ D E+ Sbjct: 617 QQGVTKQPGCSWIEVESRVHVFLVKDKSHPHRKQIYSVLKMLTEQMKRVGYIPDANDFEA 676 >ref|XP_003602631.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355491679|gb|AES72882.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 705 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/69 (47%), Positives = 47/69 (68%) Frame = +3 Query: 9 GVVKQPGRSWIEINNQVHVFMVKDKTHPQRKEVYKLLNILAAQMKRTRYVLDVGHPESKT 188 GV+KQPG SWI I + +HVFMVKDK HP +K++Y +L IL QMKR YV + + + Sbjct: 624 GVIKQPGCSWISIQSHLHVFMVKDKRHPHKKDIYLILKILTEQMKRVGYVPEA--DDDEP 681 Query: 189 YKEPMEMDI 215 Y+E + ++ Sbjct: 682 YEEESDSEL 690 >ref|XP_003540710.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Glycine max] Length = 705 Score = 72.4 bits (176), Expect = 4e-11 Identities = 40/90 (44%), Positives = 53/90 (58%) Frame = +3 Query: 3 RRGVVKQPGRSWIEINNQVHVFMVKDKTHPQRKEVYKLLNILAAQMKRTRYVLDVGHPES 182 +RGV+KQPG SWIEI ++VHVFMVKDK HP +K+++ +L L QMK YV Sbjct: 622 QRGVIKQPGCSWIEIQSRVHVFMVKDKRHPLKKDIHLVLKFLTEQMKWAGYV-------- 673 Query: 183 KTYKEPMEMDIREGCIAE*FSQMVVQFETD 272 E D E C E S++V+ FE + Sbjct: 674 ------PEADDDEICEEESDSELVLHFEME 697