BLASTX nr result
ID: Coptis24_contig00022901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022901 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518718.1| UDP-glucosyltransferase, putative [Ricinus c... 77 2e-12 gb|AAS94329.1| UDP-glucose:flavonoid-O-glucosyltransferase [Beta... 76 2e-12 ref|XP_002518717.1| UDP-glucosyltransferase, putative [Ricinus c... 76 2e-12 ref|XP_002518719.1| UDP-glucosyltransferase, putative [Ricinus c... 75 5e-12 emb|CAB56231.1| betanidin-5-O-glucosyltransferase [Cleretum bell... 74 9e-12 >ref|XP_002518718.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223542099|gb|EEF43643.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 480 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +2 Query: 65 LVNSFYELEAAYAKYFTNEMGRRAWHIGPVSLYNRNIIDKAQRGKKSSI 211 LVNSFYELE Y Y+ N +GRRAWHIGPVSL NR + DKAQRGK++SI Sbjct: 218 LVNSFYELEPGYVDYYKNVLGRRAWHIGPVSLCNRTLKDKAQRGKETSI 266 >gb|AAS94329.1| UDP-glucose:flavonoid-O-glucosyltransferase [Beta vulgaris] Length = 476 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = +2 Query: 65 LVNSFYELEAAYAKYFTNEMGRRAWHIGPVSLYNRNIIDKAQRGKKSSI 211 LVNSFYELE YA+YF ++GRRAW+IGPVSLYNR+ +KAQRGK++SI Sbjct: 221 LVNSFYELEPDYAEYFRKDLGRRAWNIGPVSLYNRSNEEKAQRGKQASI 269 >ref|XP_002518717.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223542098|gb|EEF43642.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 480 Score = 76.3 bits (186), Expect = 2e-12 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +2 Query: 65 LVNSFYELEAAYAKYFTNEMGRRAWHIGPVSLYNRNIIDKAQRGKKSSI 211 +VNSFYELE+ Y Y+ N +GRRAWHIGPVSL NRN+ +K+QRGK++SI Sbjct: 221 IVNSFYELESGYVDYYRNVLGRRAWHIGPVSLCNRNLEEKSQRGKEASI 269 >ref|XP_002518719.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223542100|gb|EEF43644.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 480 Score = 75.1 bits (183), Expect = 5e-12 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +2 Query: 65 LVNSFYELEAAYAKYFTNEMGRRAWHIGPVSLYNRNIIDKAQRGKKSSI 211 +VNS YELE AYA Y+ N +GRRAWHIGPVSL N+N +K+ RGKKSSI Sbjct: 218 IVNSVYELELAYADYYRNTLGRRAWHIGPVSLCNKNFQEKSHRGKKSSI 266 >emb|CAB56231.1| betanidin-5-O-glucosyltransferase [Cleretum bellidiforme] Length = 489 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +2 Query: 65 LVNSFYELEAAYAKYFTNEMGRRAWHIGPVSLYNRNIIDKAQRGKKSSI 211 +VNSFYELE YA + E+GRRAWHIGPVSL NR+I DKAQRG+++SI Sbjct: 222 IVNSFYELEPDYADFLRKELGRRAWHIGPVSLCNRSIEDKAQRGRQTSI 270