BLASTX nr result
ID: Coptis24_contig00022849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022849 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535310.1| conserved hypothetical protein [Ricinus comm... 104 2e-23 ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 111 7e-23 ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago ... 106 2e-21 gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays su... 86 3e-21 gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays su... 86 3e-21 >ref|XP_002535310.1| conserved hypothetical protein [Ricinus communis] gi|255590896|ref|XP_002535392.1| conserved hypothetical protein [Ricinus communis] gi|223523262|gb|EEF26991.1| conserved hypothetical protein [Ricinus communis] gi|223523475|gb|EEF27071.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 104 bits (260), Expect(2) = 2e-23 Identities = 53/63 (84%), Positives = 54/63 (85%) Frame = -3 Query: 291 VSLFLQFVPYFSKKKGVGGRCRCPGRTRLLLTLEDHRKTPGTRACRERSTLGGRASTVSP 112 VSLFL + KKK VGGRCRCPGRTRLLLTLEDHR PGTRACRERSTLGGRASTVSP Sbjct: 35 VSLFLCPI---LKKKSVGGRCRCPGRTRLLLTLEDHRNIPGTRACRERSTLGGRASTVSP 91 Query: 111 GHS 103 GHS Sbjct: 92 GHS 94 Score = 29.6 bits (65), Expect(2) = 2e-23 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 341 SDPSRFSEGDRESNR 297 SD SRFSEGDRES+R Sbjct: 18 SDSSRFSEGDRESHR 32 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 111 bits (277), Expect = 7e-23 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = +3 Query: 3 GPGCASDRHIHRGVVARVSRPGILHLAFMISTFNCAPETRSKHARPVCFFHDMLWS 170 GPGCASDRH+ GVVARVSRPGILHLAFMISTF CAPETRSKHARPVCFFHDMLWS Sbjct: 745 GPGCASDRHM--GVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHDMLWS 798 >ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago truncatula] gi|355477353|gb|AES58556.1| hypothetical protein MTR_1g005670 [Medicago truncatula] Length = 250 Score = 106 bits (264), Expect = 2e-21 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = +3 Query: 87 MISTFNCAPETRSKHARPVCFFHDMLWSRVSSCGLLALEEVVSVPDICNVLP 242 MISTFNCAPETRSKHARPVCFFHDMLWSRVSS GLLALEEVVSVPDIC VLP Sbjct: 1 MISTFNCAPETRSKHARPVCFFHDMLWSRVSSSGLLALEEVVSVPDICYVLP 52 >gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|102579661|gb|ABF70941.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] Length = 163 Score = 86.3 bits (212), Expect(2) = 3e-21 Identities = 45/60 (75%), Positives = 45/60 (75%) Frame = -3 Query: 291 VSLFLQFVPYFSKKKGVGGRCRCPGRTRLLLTLEDHRKTPGTRACRERSTLGGRASTVSP 112 V LFL FV KGV GRCRCPGRTRLLLTLEDHRK PGTRACRER T GGRAS P Sbjct: 36 VRLFLIFV---CPPKGVRGRCRCPGRTRLLLTLEDHRKKPGTRACRERRTRGGRASDQCP 92 Score = 40.4 bits (93), Expect(2) = 3e-21 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -1 Query: 341 SDPSRFSEGDRESNRMGSVFSF 276 SDPSRFSEGDRES+RMGSV F Sbjct: 18 SDPSRFSEGDRESHRMGSVRLF 39 >gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|93116158|gb|ABE98789.1| hypothetical protein [Zea mays subsp. mays] gi|413954480|gb|AFW87129.1| putative uncharacterized protein orf127 [Zea mays] Length = 159 Score = 86.3 bits (212), Expect(2) = 3e-21 Identities = 45/60 (75%), Positives = 45/60 (75%) Frame = -3 Query: 291 VSLFLQFVPYFSKKKGVGGRCRCPGRTRLLLTLEDHRKTPGTRACRERSTLGGRASTVSP 112 V LFL FV KGV GRCRCPGRTRLLLTLEDHRK PGTRACRER T GGRAS P Sbjct: 36 VRLFLIFV---CPPKGVRGRCRCPGRTRLLLTLEDHRKKPGTRACRERRTRGGRASDQCP 92 Score = 40.4 bits (93), Expect(2) = 3e-21 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -1 Query: 341 SDPSRFSEGDRESNRMGSVFSF 276 SDPSRFSEGDRES+RMGSV F Sbjct: 18 SDPSRFSEGDRESHRMGSVRLF 39