BLASTX nr result
ID: Coptis24_contig00022757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022757 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002880484.1| armadillo/beta-catenin repeat family protein... 67 1e-09 ref|NP_179895.6| RING/U-box domain and ARM repeat-containing pro... 67 1e-09 ref|NP_001189583.1| RING/U-box domain and ARM repeat-containing ... 67 1e-09 gb|AAO61490.1| arm repeat-containing protein [Nicotiana tabacum] 65 6e-09 ref|XP_002332232.1| predicted protein [Populus trichocarpa] gi|2... 65 7e-09 >ref|XP_002880484.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297326323|gb|EFH56743.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 829 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 VPPLVALSQSGTPRAKEKAQALLSYFRNQQ-GNAGRG 110 VPPLVALSQSGTPRA+EKAQALLSYFRNQ+ GNAGRG Sbjct: 793 VPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG 829 >ref|NP_179895.6| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] gi|330252323|gb|AEC07417.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] Length = 829 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 VPPLVALSQSGTPRAKEKAQALLSYFRNQQ-GNAGRG 110 VPPLVALSQSGTPRA+EKAQALLSYFRNQ+ GNAGRG Sbjct: 793 VPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG 829 >ref|NP_001189583.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] gi|357529165|sp|O22193.3|PUB4_ARATH RecName: Full=U-box domain-containing protein 4; AltName: Full=Plant U-box protein 4 gi|330252324|gb|AEC07418.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] Length = 826 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 VPPLVALSQSGTPRAKEKAQALLSYFRNQQ-GNAGRG 110 VPPLVALSQSGTPRA+EKAQALLSYFRNQ+ GNAGRG Sbjct: 790 VPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG 826 >gb|AAO61490.1| arm repeat-containing protein [Nicotiana tabacum] Length = 790 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/37 (89%), Positives = 35/37 (94%), Gaps = 1/37 (2%) Frame = +3 Query: 3 VPPLVALSQSGTPRAKEKAQALLSYFRNQQ-GNAGRG 110 VPPLVALSQSGTPRA+EKAQ LLSYFRNQ+ GNAGRG Sbjct: 754 VPPLVALSQSGTPRAREKAQQLLSYFRNQRHGNAGRG 790 >ref|XP_002332232.1| predicted protein [Populus trichocarpa] gi|222831845|gb|EEE70322.1| predicted protein [Populus trichocarpa] Length = 698 Score = 64.7 bits (156), Expect = 7e-09 Identities = 33/36 (91%), Positives = 35/36 (97%), Gaps = 1/36 (2%) Frame = +3 Query: 3 VPPLVALSQSGTPRAKEKAQALLSYFRNQQ-GNAGR 107 VPPLVALSQSGTPRAKEKAQ+LLSYFRNQ+ GNAGR Sbjct: 663 VPPLVALSQSGTPRAKEKAQSLLSYFRNQRHGNAGR 698