BLASTX nr result
ID: Coptis24_contig00022420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022420 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002836076.1| ATP synthase CF0 subunit I [Megaleranthis sa... 191 5e-47 ref|YP_001294170.1| ATP synthase CF0 subunit I [Buxus microphyll... 189 2e-46 gb|AAZ03832.1| ATP synthase CF0 B chain [Ranunculus macranthus] 187 8e-46 ref|YP_001004172.1| ATP synthase CF0 subunit I [Ranunculus macra... 187 8e-46 ref|YP_740551.1| ATP synthase CF0 subunit I [Platanus occidental... 187 1e-45 >ref|YP_002836076.1| ATP synthase CF0 subunit I [Megaleranthis saniculifolia] gi|226933868|gb|ACO92001.1| ATP synthase CF0 subunit I [Megaleranthis saniculifolia] Length = 184 Score = 191 bits (485), Expect = 5e-47 Identities = 96/101 (95%), Positives = 99/101 (98%) Frame = -1 Query: 323 RLWKVKMEADEFRVNGYSEIEREKVNLINSTYQNLERLENYKNETIQFEQERAINQVRQR 144 RL KV+MEADEFRVNGYSEIEREK NLINSTYQNLERLENYKNETIQFEQ+RAINQVRQR Sbjct: 84 RLRKVQMEADEFRVNGYSEIEREKFNLINSTYQNLERLENYKNETIQFEQQRAINQVRQR 143 Query: 143 VFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEITD 21 VFQQAL+GALGTLNSCLNNELHLRTISANIGMFGAMKEITD Sbjct: 144 VFQQALEGALGTLNSCLNNELHLRTISANIGMFGAMKEITD 184 >ref|YP_001294170.1| ATP synthase CF0 subunit I [Buxus microphylla] gi|226741352|sp|A6MM22.1|ATPF_BUXMI RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I gi|146762271|gb|ABQ45235.1| ATP synthase CF0 subunit I [Buxus microphylla] Length = 184 Score = 189 bits (481), Expect = 2e-46 Identities = 95/101 (94%), Positives = 99/101 (98%) Frame = -1 Query: 323 RLWKVKMEADEFRVNGYSEIEREKVNLINSTYQNLERLENYKNETIQFEQERAINQVRQR 144 RL KV+MEADEFRVNGYSEIEREK+NLINSTY+NLERLENYKNETI FEQ+RAINQVRQR Sbjct: 84 RLRKVEMEADEFRVNGYSEIEREKLNLINSTYKNLERLENYKNETIHFEQQRAINQVRQR 143 Query: 143 VFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEITD 21 VFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEITD Sbjct: 144 VFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEITD 184 >gb|AAZ03832.1| ATP synthase CF0 B chain [Ranunculus macranthus] Length = 188 Score = 187 bits (475), Expect = 8e-46 Identities = 94/100 (94%), Positives = 96/100 (96%) Frame = -1 Query: 323 RLWKVKMEADEFRVNGYSEIEREKVNLINSTYQNLERLENYKNETIQFEQERAINQVRQR 144 RL KVK EADEFR NGYSEIEREK NLINSTYQNLERLENYKNETIQFEQ+RAINQVRQR Sbjct: 89 RLRKVKAEADEFRTNGYSEIEREKCNLINSTYQNLERLENYKNETIQFEQQRAINQVRQR 148 Query: 143 VFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEIT 24 +FQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEIT Sbjct: 149 IFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEIT 188 >ref|YP_001004172.1| ATP synthase CF0 subunit I [Ranunculus macranthus] gi|226694449|sp|A1XGM4.1|ATPF_RANMC RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I gi|85540790|gb|ABC70742.1| ATP synthase CF0 subunit I [Ranunculus macranthus] Length = 183 Score = 187 bits (475), Expect = 8e-46 Identities = 94/100 (94%), Positives = 96/100 (96%) Frame = -1 Query: 323 RLWKVKMEADEFRVNGYSEIEREKVNLINSTYQNLERLENYKNETIQFEQERAINQVRQR 144 RL KVK EADEFR NGYSEIEREK NLINSTYQNLERLENYKNETIQFEQ+RAINQVRQR Sbjct: 84 RLRKVKAEADEFRTNGYSEIEREKCNLINSTYQNLERLENYKNETIQFEQQRAINQVRQR 143 Query: 143 VFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEIT 24 +FQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEIT Sbjct: 144 IFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEIT 183 >ref|YP_740551.1| ATP synthase CF0 subunit I [Platanus occidentalis] gi|122166049|sp|Q09G60.1|ATPF_PLAOC RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I gi|114054370|gb|ABI49764.1| ATP synthase CF0 subunit I [Platanus occidentalis] Length = 184 Score = 187 bits (474), Expect = 1e-45 Identities = 94/101 (93%), Positives = 98/101 (97%) Frame = -1 Query: 323 RLWKVKMEADEFRVNGYSEIEREKVNLINSTYQNLERLENYKNETIQFEQERAINQVRQR 144 RL KV+MEADEFRVNGYSEIEREK+NLINSTY+NLERLENYKNETIQFEQ+RAINQVRQR Sbjct: 84 RLRKVEMEADEFRVNGYSEIEREKLNLINSTYKNLERLENYKNETIQFEQQRAINQVRQR 143 Query: 143 VFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMKEITD 21 VFQQALQ ALGTLNSCLNNELHLRTISANIGMFG MKEITD Sbjct: 144 VFQQALQRALGTLNSCLNNELHLRTISANIGMFGTMKEITD 184