BLASTX nr result
ID: Coptis24_contig00022368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022368 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002337688.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002337688.1| predicted protein [Populus trichocarpa] gi|222869559|gb|EEF06690.1| predicted protein [Populus trichocarpa] Length = 528 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 127 NGLADSGKFIEKQFEFKPTFDDYLKAMESVKTGRETKPV 243 N L SG IEK+FEFKP+F +YLKAMESVKTGRE V Sbjct: 18 NRLVGSGGVIEKEFEFKPSFGEYLKAMESVKTGREKNQV 56