BLASTX nr result
ID: Coptis24_contig00022355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022355 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530894.1| pentatricopeptide repeat-containing protein,... 136 2e-30 ref|XP_002267278.1| PREDICTED: pentatricopeptide repeat-containi... 131 7e-29 ref|NP_175673.1| pentatricopeptide repeat-containing protein [Ar... 124 8e-27 ref|XP_002305285.1| predicted protein [Populus trichocarpa] gi|2... 124 8e-27 ref|XP_002894392.1| pentatricopeptide repeat-containing protein ... 122 4e-26 >ref|XP_002530894.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529547|gb|EEF31500.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 519 Score = 136 bits (343), Expect = 2e-30 Identities = 61/95 (64%), Positives = 80/95 (84%) Frame = -2 Query: 286 RNSHHILVDILGSSKQFPLIWNFLSDIRDGGDYEISSEMFWIVFRSYSRAGLPMDAIRAF 107 + S+HILVDILGSSKQF L+W+FL +IR+ D+EIS ++FW+VFR+YSRA LP DAIRAF Sbjct: 108 KESYHILVDILGSSKQFALLWDFLIEIRESQDFEISPQVFWLVFRAYSRANLPSDAIRAF 167 Query: 106 EKMHDYDLKPGVDDLDQLVFTLCKRKLVKHAQEFF 2 ++M ++ LKP +DDLDQL++ LCKRK KHAQ+ F Sbjct: 168 DRMVEFGLKPTIDDLDQLLYVLCKRKHAKHAQQIF 202 >ref|XP_002267278.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Vitis vinifera] Length = 624 Score = 131 bits (329), Expect = 7e-29 Identities = 62/95 (65%), Positives = 77/95 (81%) Frame = -2 Query: 286 RNSHHILVDILGSSKQFPLIWNFLSDIRDGGDYEISSEMFWIVFRSYSRAGLPMDAIRAF 107 + S+HILVDILGSSKQFPLIW+FLSD+R+ EI E+FW++FR+Y RA LP DAIRAF Sbjct: 114 KESYHILVDILGSSKQFPLIWDFLSDMRETRCCEICPEIFWLIFRAYCRANLPGDAIRAF 173 Query: 106 EKMHDYDLKPGVDDLDQLVFTLCKRKLVKHAQEFF 2 +M D+ +K GV D+DQL++ LCKRK VK AQEFF Sbjct: 174 HQMGDFGVKAGVGDVDQLLYVLCKRKHVKQAQEFF 208 >ref|NP_175673.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207559|sp|Q9SSR6.1|PPR78_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g52640, mitochondrial; Flags: Precursor gi|5903042|gb|AAD55601.1|AC008016_11 Contains 2 PF|01535 DUF domains [Arabidopsis thaliana] gi|45773940|gb|AAS76774.1| At1g52640 [Arabidopsis thaliana] gi|62320530|dbj|BAD95108.1| hypothetical protein [Arabidopsis thaliana] gi|332194712|gb|AEE32833.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 523 Score = 124 bits (311), Expect = 8e-27 Identities = 58/93 (62%), Positives = 76/93 (81%) Frame = -2 Query: 280 SHHILVDILGSSKQFPLIWNFLSDIRDGGDYEISSEMFWIVFRSYSRAGLPMDAIRAFEK 101 S+HILV+ILGSSKQF L+W+FL + R+ +EISS++FWIVFR+YSRA LP +A RAF + Sbjct: 104 SYHILVEILGSSKQFALLWDFLIEAREYNYFEISSKVFWIVFRAYSRANLPSEACRAFNR 163 Query: 100 MHDYDLKPGVDDLDQLVFTLCKRKLVKHAQEFF 2 M ++ +KP VDDLDQL+ +LC +K V HAQEFF Sbjct: 164 MVEFGIKPCVDDLDQLLHSLCDKKHVNHAQEFF 196 >ref|XP_002305285.1| predicted protein [Populus trichocarpa] gi|222848249|gb|EEE85796.1| predicted protein [Populus trichocarpa] Length = 523 Score = 124 bits (311), Expect = 8e-27 Identities = 55/93 (59%), Positives = 78/93 (83%) Frame = -2 Query: 280 SHHILVDILGSSKQFPLIWNFLSDIRDGGDYEISSEMFWIVFRSYSRAGLPMDAIRAFEK 101 S+HILV+ILG+S+QF ++W+FL ++R+ D+EI+ E+ W+VFRSYSRA LP DAIRAF++ Sbjct: 114 SYHILVNILGTSRQFAILWDFLIEMRESHDFEINQEIIWLVFRSYSRANLPSDAIRAFDR 173 Query: 100 MHDYDLKPGVDDLDQLVFTLCKRKLVKHAQEFF 2 M ++ L+P VDDLD+L++ LCK K VK AQ+FF Sbjct: 174 MAEFGLRPSVDDLDKLLYVLCKCKHVKCAQQFF 206 >ref|XP_002894392.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297340234|gb|EFH70651.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 525 Score = 122 bits (305), Expect = 4e-26 Identities = 57/93 (61%), Positives = 75/93 (80%) Frame = -2 Query: 280 SHHILVDILGSSKQFPLIWNFLSDIRDGGDYEISSEMFWIVFRSYSRAGLPMDAIRAFEK 101 S+HILV+ILG SKQF L+W+FL + R+ +EI+S++FWIVFR+YSRA LP +A RAF + Sbjct: 104 SYHILVEILGCSKQFALLWDFLIEAREYNYFEITSKVFWIVFRAYSRANLPSEASRAFNR 163 Query: 100 MHDYDLKPGVDDLDQLVFTLCKRKLVKHAQEFF 2 M ++ +KP VDDLDQL+ +LC RK V HAQEFF Sbjct: 164 MVEFGIKPCVDDLDQLLHSLCDRKHVNHAQEFF 196