BLASTX nr result
ID: Coptis24_contig00022347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022347 (534 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 91 1e-16 ref|XP_004154721.1| PREDICTED: pentatricopeptide repeat-containi... 84 1e-14 ref|XP_004144886.1| PREDICTED: pentatricopeptide repeat-containi... 84 1e-14 ref|NP_179305.2| pentatricopeptide repeat-containing protein [Ar... 70 2e-10 >ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] gi|297744485|emb|CBI37747.3| unnamed protein product [Vitis vinifera] Length = 878 Score = 98.6 bits (244), Expect = 5e-19 Identities = 52/105 (49%), Positives = 68/105 (64%), Gaps = 6/105 (5%) Frame = +1 Query: 232 ELRKALLKQKNKPSLAWHLFKHLLTSQTPSS------LSNSIPTITHILISSKMFQQLDH 393 +L KAL+K + P+LAWHLFK +L+ T SS + SIP ITHILI +KM Q+DH Sbjct: 6 KLTKALIKNTHNPTLAWHLFKRILSIPTSSSSISSRSILRSIPIITHILIRAKMISQIDH 65 Query: 394 LHNLILLQPPDISYIYLTTLTQASAKSGLLNKALSQFDSLRSHFP 528 L L+L QP ++S++ L L + AKSGL + A SQF S RS P Sbjct: 66 LQQLLLQQPQEVSHVSLIALIRILAKSGLSDLAFSQFQSFRSQVP 110 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 90.5 bits (223), Expect = 1e-16 Identities = 53/105 (50%), Positives = 65/105 (61%), Gaps = 2/105 (1%) Frame = +1 Query: 226 TMELRKALLKQKNKPSLAWHLFKHLLTSQTPSS-LSNSIPTITHILISSKMFQQLDHLHN 402 T +L KALL + P LAWHLFK +L+ S+ S SIP I+ ILI SKMF +LD LH Sbjct: 4 TTKLTKALLNNAHNPKLAWHLFKRILSLPISSNHRSQSIPIISRILIRSKMFNELDDLHQ 63 Query: 403 LILLQPP-DISYIYLTTLTQASAKSGLLNKALSQFDSLRSHFPTR 534 L+L P + S L L AKSG NKA+S F SLRS+FP + Sbjct: 64 LLLNSPSLESSDSSLENLVTVLAKSGFFNKAISHFKSLRSNFPEK 108 >ref|XP_004154721.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Cucumis sativus] Length = 875 Score = 84.3 bits (207), Expect = 1e-14 Identities = 47/105 (44%), Positives = 63/105 (60%), Gaps = 6/105 (5%) Frame = +1 Query: 232 ELRKALLKQKNKPSLAWHLFKHLLTSQTPSSLS------NSIPTITHILISSKMFQQLDH 393 +L KA+ N P+LAW LFK +L+S P+S S S+P I ILI++KM Q+DH Sbjct: 8 KLSKAIYLNSNNPNLAWLLFKRILSSPIPASSSFFKPSLQSVPAIARILITAKMHPQIDH 67 Query: 394 LHNLILLQPPDISYIYLTTLTQASAKSGLLNKALSQFDSLRSHFP 528 LH L+L Q D ++ +L + A GLL A+SQF SLR FP Sbjct: 68 LHQLLLSQHRDFAHPSGFSLVRTLADLGLLENAISQFRSLRDRFP 112 >ref|XP_004144886.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Cucumis sativus] gi|449472527|ref|XP_004153621.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Cucumis sativus] Length = 875 Score = 84.3 bits (207), Expect = 1e-14 Identities = 47/105 (44%), Positives = 63/105 (60%), Gaps = 6/105 (5%) Frame = +1 Query: 232 ELRKALLKQKNKPSLAWHLFKHLLTSQTPSSLS------NSIPTITHILISSKMFQQLDH 393 +L KA+ N P+LAW LFK +L+S P+S S S+P I ILI++KM Q+DH Sbjct: 8 KLSKAIYLNSNNPNLAWLLFKRILSSPIPASSSFFKPSLQSVPAIARILITAKMHPQIDH 67 Query: 394 LHNLILLQPPDISYIYLTTLTQASAKSGLLNKALSQFDSLRSHFP 528 LH L+L Q D ++ +L + A GLL A+SQF SLR FP Sbjct: 68 LHQLLLSQHRDFAHPSGFSLVRTLADLGLLENAISQFRSLRDRFP 112 >ref|NP_179305.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122223754|sp|Q0WPZ6.1|PP158_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17140 gi|110737729|dbj|BAF00803.1| hypothetical protein [Arabidopsis thaliana] gi|330251496|gb|AEC06590.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 874 Score = 70.1 bits (170), Expect = 2e-10 Identities = 43/104 (41%), Positives = 60/104 (57%), Gaps = 6/104 (5%) Frame = +1 Query: 235 LRKALLKQKNKPSLAWHLFKHLLTSQTPSSLSNSI---PTITHILISSKMFQQLDHLHNL 405 L KALLK N P LAW +FK + +S + S S+ PTI IL+ +KM +++ LHNL Sbjct: 5 LVKALLKNTNNPRLAWRIFKRIFSSPSEESHGISLDATPTIARILVRAKMHEEIQELHNL 64 Query: 406 IL---LQPPDISYIYLTTLTQASAKSGLLNKALSQFDSLRSHFP 528 IL +Q +S L ++ AKS ++KA QF +RS FP Sbjct: 65 ILSSSIQKTKLS--SLLSVVSIFAKSNHIDKAFPQFQLVRSRFP 106