BLASTX nr result
ID: Coptis24_contig00021954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00021954 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514843.1| pentatricopeptide repeat-containing protein,... 57 2e-06 ref|XP_003629614.1| Pentatricopeptide repeat-containing protein ... 56 4e-06 ref|XP_003633275.1| PREDICTED: putative pentatricopeptide repeat... 55 6e-06 >ref|XP_002514843.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545894|gb|EEF47397.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 594 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/58 (44%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +1 Query: 199 VRDRSKSGTLG-LDEALGFFNRLIRYRPLPSIHPFTQLLGALVKTKHFSTVLSMYNAM 369 VRD+ K G+ D+AL +FN+++ P P I F QLL ALV+ KH+ +V+S+Y M Sbjct: 73 VRDKCKGGSFSNFDDALAYFNQMVHMNPFPCITQFNQLLAALVRMKHYDSVVSIYRKM 130 >ref|XP_003629614.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523636|gb|AET04090.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 592 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/58 (46%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +1 Query: 199 VRDRSKSGTL-GLDEALGFFNRLIRYRPLPSIHPFTQLLGALVKTKHFSTVLSMYNAM 369 +R++ KSG L +DEAL FF+ + + PLPS+ FT LLG +VK KH++T +S+ M Sbjct: 44 MRNQCKSGKLKSIDEALNFFHTMAKMNPLPSVIDFTLLLGFIVKMKHYTTAISLVKEM 101 >ref|XP_003633275.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Vitis vinifera] Length = 572 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = +1 Query: 232 LDEALGFFNRLIRYRPLPSIHPFTQLLGALVKTKHFSTVLSMYNAM 369 +D+AL FNR++R RP PSI F++LL ++ + KH+STVLS+Y M Sbjct: 35 IDDALSLFNRMLRMRPPPSIVDFSKLLTSITRMKHYSTVLSLYKQM 80