BLASTX nr result
ID: Coptis24_contig00021323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00021323 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003522059.1| PREDICTED: LRR receptor-like serine/threonin... 42 1e-06 >ref|XP_003522059.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Glycine max] Length = 1067 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +1 Query: 22 IPESLSNIKYLRTLDLSNNNFSGEIPESLAMRNSNI 129 IP+SL N YL+ LDLSNNN SG IP L + N+ Sbjct: 662 IPDSLCNAFYLKVLDLSNNNISGTIPSCLMTVSENL 697 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +2 Query: 152 LWTLRLNGNQFTGIIP-NLEFSSPLQILDL 238 LWTL L GNQ G IP +L + S L++LDL Sbjct: 721 LWTLNLRGNQLDGPIPKSLAYCSKLEVLDL 750