BLASTX nr result
ID: Coptis24_contig00021291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00021291 (198 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002442327.1| hypothetical protein SORBIDRAFT_08g018260 [S... 55 8e-06 >ref|XP_002442327.1| hypothetical protein SORBIDRAFT_08g018260 [Sorghum bicolor] gi|241943020|gb|EES16165.1| hypothetical protein SORBIDRAFT_08g018260 [Sorghum bicolor] Length = 576 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/62 (43%), Positives = 36/62 (58%) Frame = +1 Query: 1 RQYEATLARVNSNYFGANPIFRDHDFRCRFRMGQLLFTRIFNYLNHNVPYFQQKVNCAGK 180 R EA R+ +YF NP++ D FR R+RM + LF +I LN PYFQQ+ + GK Sbjct: 72 RDREAGQNRLIRDYFSTNPVYTDEQFRRRYRMRRHLFLQIVQALNDWSPYFQQRSDATGK 131 Query: 181 FG 186 G Sbjct: 132 LG 133