BLASTX nr result
ID: Coptis24_contig00020891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00020891 (533 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002891232.1| zinc finger family protein [Arabidopsis lyra... 66 3e-09 ref|XP_001909181.1| hypothetical protein [Podospora anserina S m... 66 3e-09 ref|NP_176239.1| RING/U-box domain-containing protein [Arabidops... 65 5e-09 gb|EKG14150.1| Zinc finger RING-type protein [Macrophomina phase... 65 6e-09 gb|EMC96423.1| hypothetical protein BAUCODRAFT_474318 [Baudoinia... 65 8e-09 >ref|XP_002891232.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297337074|gb|EFH67491.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 326 Score = 66.2 bits (160), Expect = 3e-09 Identities = 23/43 (53%), Positives = 33/43 (76%) Frame = -1 Query: 191 ICLDEYLIGDYVTAMPCSHLYHKDCIEAWLRKTNTCPLCRSGL 63 +C++E+++G T +PC H+YHKDCI WLR N+CP+CRS L Sbjct: 225 VCMEEFIVGGDATELPCKHIYHKDCIIPWLRLHNSCPICRSDL 267 >ref|XP_001909181.1| hypothetical protein [Podospora anserina S mat+] gi|170944203|emb|CAP70313.1| unnamed protein product [Podospora anserina S mat+] Length = 622 Score = 66.2 bits (160), Expect = 3e-09 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = -1 Query: 191 ICLDEYLIGDYVTAMPCSHLYHKDCIEAWLRKTNTCPLCRSGLQ 60 IC+DE+ +GD VT +PCSH YH +C+ WL++ NTCP+CR ++ Sbjct: 350 ICIDEFKMGDEVTVLPCSHWYHGECVVLWLKEHNTCPICRKPIE 393 >ref|NP_176239.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|3249088|gb|AAC24072.1| Contains similarity to goliath protein gb|M97204 from D. melanogster [Arabidopsis thaliana] gi|332195557|gb|AEE33678.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 327 Score = 65.5 bits (158), Expect = 5e-09 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = -1 Query: 191 ICLDEYLIGDYVTAMPCSHLYHKDCIEAWLRKTNTCPLCRSGL 63 +C++E+++G T +PC H+YHKDCI WLR N+CP+CR L Sbjct: 226 VCMEEFIVGGDATELPCKHIYHKDCIVPWLRLNNSCPICRRDL 268 >gb|EKG14150.1| Zinc finger RING-type protein [Macrophomina phaseolina MS6] Length = 585 Score = 65.1 bits (157), Expect = 6e-09 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -1 Query: 191 ICLDEYLIGDYVTAMPCSHLYHKDCIEAWLRKTNTCPLCRSGLQ 60 IC+DE IG+ VT +PC H +H CIEAWLR+ +TCP CR G++ Sbjct: 332 ICMDEVPIGEEVTELPCGHWFHGQCIEAWLREHDTCPHCRKGIE 375 >gb|EMC96423.1| hypothetical protein BAUCODRAFT_474318 [Baudoinia compniacensis UAMH 10762] Length = 502 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -1 Query: 191 ICLDEYLIGDYVTAMPCSHLYHKDCIEAWLRKTNTCPLCRSGL 63 IC+DE IG+ VT +PCSH +H DCI+AWL + +TCP CR G+ Sbjct: 342 ICMDEVNIGETVTVLPCSHWFHGDCIKAWLSEHDTCPHCRQGI 384