BLASTX nr result
ID: Coptis24_contig00020574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00020574 (453 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW16955.1| translationally controlled tumor protein [Salvia ... 75 7e-12 gb|ABR92336.1| putative translationally controlled tumor protein... 75 7e-12 gb|ABC55649.1| translationally controlled tumor protein [Hevea b... 74 9e-12 gb|AEH05972.1| translationally controlled tumor protein [Hevea b... 74 9e-12 ref|XP_002453140.1| hypothetical protein SORBIDRAFT_04g000750 [S... 74 9e-12 >gb|ABW16955.1| translationally controlled tumor protein [Salvia miltiorrhiza] Length = 168 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 1 GESMHDDASMVFAYYREGATDPTFLYFAHALKEIKC 108 GESMHDD+S+VFAYY+EGATDPTFLYFAH LKEIKC Sbjct: 133 GESMHDDSSLVFAYYKEGATDPTFLYFAHGLKEIKC 168 >gb|ABR92336.1| putative translationally controlled tumor protein [Salvia miltiorrhiza] Length = 168 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 1 GESMHDDASMVFAYYREGATDPTFLYFAHALKEIKC 108 GESMHDD+S+VFAYY+EGATDPTFLYFAH LKEIKC Sbjct: 133 GESMHDDSSLVFAYYKEGATDPTFLYFAHGLKEIKC 168 >gb|ABC55649.1| translationally controlled tumor protein [Hevea brasiliensis] Length = 168 Score = 74.3 bits (181), Expect = 9e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 1 GESMHDDASMVFAYYREGATDPTFLYFAHALKEIKC 108 GESMHDD S+VFAYYREGATDPTFLYFA+ALKE+KC Sbjct: 133 GESMHDDGSLVFAYYREGATDPTFLYFAYALKEVKC 168 >gb|AEH05972.1| translationally controlled tumor protein [Hevea brasiliensis] gi|392514569|gb|AFM77714.1| TCTP.1 [Hevea brasiliensis] Length = 168 Score = 74.3 bits (181), Expect = 9e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 1 GESMHDDASMVFAYYREGATDPTFLYFAHALKEIKC 108 GESMHDD S+VFAYYREGATDPTFLYFA+ALKE+KC Sbjct: 133 GESMHDDGSLVFAYYREGATDPTFLYFAYALKEVKC 168 >ref|XP_002453140.1| hypothetical protein SORBIDRAFT_04g000750 [Sorghum bicolor] gi|241932971|gb|EES06116.1| hypothetical protein SORBIDRAFT_04g000750 [Sorghum bicolor] Length = 167 Score = 74.3 bits (181), Expect = 9e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 1 GESMHDDASMVFAYYREGATDPTFLYFAHALKEIKC 108 GESMHDD S+VFAYY+EGATDPTFLYFAH LKEIKC Sbjct: 132 GESMHDDGSLVFAYYKEGATDPTFLYFAHGLKEIKC 167