BLASTX nr result
ID: Coptis24_contig00020389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00020389 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38550.3| unnamed protein product [Vitis vinifera] 67 1e-09 ref|XP_002277434.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 emb|CAN66681.1| hypothetical protein VITISV_005087 [Vitis vinifera] 67 1e-09 ref|XP_004168937.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_004151848.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 62 6e-08 >emb|CBI38550.3| unnamed protein product [Vitis vinifera] Length = 795 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +1 Query: 13 ERLFKEMNENGFIPCKGTLVCISSGLARPGKKGEAKRLLQTLYKRE 150 +RLF+EMNE GFIPC+ TL CIS LA+PGKK +A+R+L LYK++ Sbjct: 748 KRLFEEMNEKGFIPCENTLACISFTLAKPGKKADAQRILNKLYKKK 793 >ref|XP_002277434.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like [Vitis vinifera] Length = 835 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +1 Query: 13 ERLFKEMNENGFIPCKGTLVCISSGLARPGKKGEAKRLLQTLYKRE 150 +RLF+EMNE GFIPC+ TL CIS LA+PGKK +A+R+L LYK++ Sbjct: 748 KRLFEEMNEKGFIPCENTLACISFTLAKPGKKADAQRILNKLYKKK 793 >emb|CAN66681.1| hypothetical protein VITISV_005087 [Vitis vinifera] Length = 882 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +1 Query: 13 ERLFKEMNENGFIPCKGTLVCISSGLARPGKKGEAKRLLQTLYKRE 150 +RLF+EMNE GFIPC+ TL CIS LA+PGKK +A+R+L LYK++ Sbjct: 748 KRLFEEMNEKGFIPCENTLACISFTLAKPGKKADAQRILNKLYKKK 793 >ref|XP_004168937.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like [Cucumis sativus] Length = 683 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = +1 Query: 1 RERRERLFKEMNENGFIPCKGTLVCISSGLARPGKKGEAKRLLQTLYKRE 150 R +RLF EMN+ GF+PC+ T CISS A PGKK +A+ LL++ YKR+ Sbjct: 632 RAEAKRLFIEMNDRGFVPCESTQACISSTFAAPGKKADARMLLKSTYKRK 681 >ref|XP_004151848.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like, partial [Cucumis sativus] Length = 697 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = +1 Query: 1 RERRERLFKEMNENGFIPCKGTLVCISSGLARPGKKGEAKRLLQTLYKRE 150 R +RLF EMN+ GF+PC+ T CISS A PGKK +A+ LL++ YKR+ Sbjct: 646 RAEAKRLFIEMNDRGFVPCESTQACISSTFAAPGKKADARMLLKSTYKRK 695