BLASTX nr result
ID: Coptis24_contig00020314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00020314 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316383.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_002311079.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_002273467.2| PREDICTED: thioredoxin-like 3-2, chloroplast... 61 8e-08 ref|NP_001238403.1| uncharacterized protein LOC100527081 [Glycin... 58 7e-07 ref|NP_196046.2| thioredoxin-like 3-2 [Arabidopsis thaliana] gi|... 55 6e-06 >ref|XP_002316383.1| predicted protein [Populus trichocarpa] gi|222865423|gb|EEF02554.1| predicted protein [Populus trichocarpa] Length = 128 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 419 VWKDSKKQAEVVGGHKAYLVVNEVREMIEN 330 +WKDSKKQAEV+GGHKAYLV+NEVREMIEN Sbjct: 98 LWKDSKKQAEVIGGHKAYLVINEVREMIEN 127 >ref|XP_002311079.1| predicted protein [Populus trichocarpa] gi|222850899|gb|EEE88446.1| predicted protein [Populus trichocarpa] Length = 128 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 419 VWKDSKKQAEVVGGHKAYLVVNEVREMIEN 330 +WKDSKKQAEV+GGHKAYLV+NEVREMIEN Sbjct: 98 LWKDSKKQAEVIGGHKAYLVINEVREMIEN 127 >ref|XP_002273467.2| PREDICTED: thioredoxin-like 3-2, chloroplastic-like [Vitis vinifera] gi|296085989|emb|CBI31430.3| unnamed protein product [Vitis vinifera] Length = 195 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 419 VWKDSKKQAEVVGGHKAYLVVNEVREMIEN 330 +WKDSKKQAEV+GGHKAY VVNEVREMIEN Sbjct: 162 LWKDSKKQAEVIGGHKAYFVVNEVREMIEN 191 >ref|NP_001238403.1| uncharacterized protein LOC100527081 [Glycine max] gi|255631512|gb|ACU16123.1| unknown [Glycine max] Length = 198 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -1 Query: 419 VWKDSKKQAEVVGGHKAYLVVNEVREMIEN 330 +W+DSKKQ EV+GGHKAYLV+NEV+EMIEN Sbjct: 159 LWRDSKKQGEVIGGHKAYLVINEVQEMIEN 188 >ref|NP_196046.2| thioredoxin-like 3-2 [Arabidopsis thaliana] gi|52000834|sp|Q8VZT6.1|TRL32_ARATH RecName: Full=Thioredoxin-like 3-2, chloroplastic; AltName: Full=Thioredoxin WCRKC-2; Flags: Precursor gi|17380752|gb|AAL36206.1| putative thioredoxin [Arabidopsis thaliana] gi|21436391|gb|AAM51365.1| putative thioredoxin [Arabidopsis thaliana] gi|332003337|gb|AED90720.1| thioredoxin-like 3-2 [Arabidopsis thaliana] Length = 192 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 419 VWKDSKKQAEVVGGHKAYLVVNEVREMIEN 330 +W+D +KQAEV+GGHKA+ VVNEVREMIEN Sbjct: 159 LWRDGQKQAEVIGGHKAHFVVNEVREMIEN 188