BLASTX nr result
ID: Coptis24_contig00020158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00020158 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O65543.2|PP343_ARATH RecName: Full=Pentatricopeptide repeat-c... 63 2e-08 ref|NP_194836.1| pentatricopeptide repeat-containing protein [Ar... 63 2e-08 ref|XP_002521663.1| pentatricopeptide repeat-containing protein,... 59 3e-07 >sp|O65543.2|PP343_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g31070, mitochondrial; Flags: Precursor Length = 624 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/56 (46%), Positives = 44/56 (78%) Frame = +2 Query: 5 LVHRLIASEPDNPASYMLSRMVYAENGDWYGAEEVQKVMRKRGLTKSSGYSQLEPE 172 + + L+ SEPDNPA+Y+L ++ E+G+++ AEEV++VM++R L K G+S++EPE Sbjct: 555 IANELMKSEPDNPANYVLLSKIHTESGNYHAAEEVRRVMQRRKLNKCYGFSKIEPE 610 >ref|NP_194836.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|2980759|emb|CAA18186.1| putative protein [Arabidopsis thaliana] gi|7270009|emb|CAB79825.1| putative protein [Arabidopsis thaliana] gi|332660453|gb|AEE85853.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 613 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/56 (46%), Positives = 44/56 (78%) Frame = +2 Query: 5 LVHRLIASEPDNPASYMLSRMVYAENGDWYGAEEVQKVMRKRGLTKSSGYSQLEPE 172 + + L+ SEPDNPA+Y+L ++ E+G+++ AEEV++VM++R L K G+S++EPE Sbjct: 544 IANELMKSEPDNPANYVLLSKIHTESGNYHAAEEVRRVMQRRKLNKCYGFSKIEPE 599 >ref|XP_002521663.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539054|gb|EEF40650.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 578 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/54 (46%), Positives = 40/54 (74%) Frame = +2 Query: 2 QLVHRLIASEPDNPASYMLSRMVYAENGDWYGAEEVQKVMRKRGLTKSSGYSQL 163 +L LI SEP N A++ L M+YAE+G+W+ E+V+++MR +GL+K G+SQ+ Sbjct: 521 RLAQELIKSEPSNAANHTLLSMIYAESGNWFAVEDVRRLMRVQGLSKCYGFSQV 574