BLASTX nr result
ID: Coptis24_contig00019995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00019995 (617 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267354.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 emb|CAN78152.1| hypothetical protein VITISV_040250 [Vitis vinifera] 78 1e-12 ref|XP_004160258.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_004151248.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 emb|CBI39775.3| unnamed protein product [Vitis vinifera] 72 6e-11 >ref|XP_002267354.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 632 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = +2 Query: 455 ERSVRSWTAMIAGYVQCGNLKEAIRMFTDMEAARGTPNEVIVVAVLASCADLGA 616 ER+VRSWT+MIAGYVQCG KEAI +F ME A NEV VVAVLA+CADLGA Sbjct: 222 ERNVRSWTSMIAGYVQCGKAKEAIHLFAKMEEAGVKCNEVTVVAVLAACADLGA 275 >emb|CAN78152.1| hypothetical protein VITISV_040250 [Vitis vinifera] Length = 606 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = +2 Query: 455 ERSVRSWTAMIAGYVQCGNLKEAIRMFTDMEAARGTPNEVIVVAVLASCADLGA 616 ER+VRSWT+MIAGYVQCG KEAI +F ME A NEV VVAVLA+CADLGA Sbjct: 222 ERNVRSWTSMIAGYVQCGKAKEAIHLFAKMEEAGVKCNEVTVVAVLAACADLGA 275 >ref|XP_004160258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 583 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/53 (66%), Positives = 41/53 (77%) Frame = +2 Query: 455 ERSVRSWTAMIAGYVQCGNLKEAIRMFTDMEAARGTPNEVIVVAVLASCADLG 613 ER+VRSWT+MI GY QCG KEAI +F +ME A PNEV VVAVL +CAD+G Sbjct: 207 ERNVRSWTSMIGGYAQCGKSKEAIDLFLEMEDAGLLPNEVTVVAVLVACADMG 259 >ref|XP_004151248.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 617 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/53 (66%), Positives = 41/53 (77%) Frame = +2 Query: 455 ERSVRSWTAMIAGYVQCGNLKEAIRMFTDMEAARGTPNEVIVVAVLASCADLG 613 ER+VRSWT+MI GY QCG KEAI +F +ME A PNEV VVAVL +CAD+G Sbjct: 207 ERNVRSWTSMIGGYAQCGKSKEAIDLFLEMEDAGLLPNEVTVVAVLVACADMG 259 >emb|CBI39775.3| unnamed protein product [Vitis vinifera] Length = 599 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/50 (72%), Positives = 39/50 (78%) Frame = +2 Query: 467 RSWTAMIAGYVQCGNLKEAIRMFTDMEAARGTPNEVIVVAVLASCADLGA 616 RSWT+MIAGYVQCG KEAI +F ME A NEV VVAVLA+CADLGA Sbjct: 193 RSWTSMIAGYVQCGKAKEAIHLFAKMEEAGVKCNEVTVVAVLAACADLGA 242