BLASTX nr result
ID: Coptis24_contig00019838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00019838 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83300.1| hypothetical protein VITISV_044100 [Vitis vinifera] 62 4e-08 emb|CAN66607.1| hypothetical protein VITISV_017554 [Vitis vinifera] 62 4e-08 emb|CAN76793.1| hypothetical protein VITISV_026680 [Vitis vinifera] 62 4e-08 emb|CAN76938.1| hypothetical protein VITISV_025425 [Vitis vinifera] 59 4e-07 ref|XP_004160268.1| PREDICTED: uncharacterized protein LOC101232... 56 3e-06 >emb|CAN83300.1| hypothetical protein VITISV_044100 [Vitis vinifera] Length = 1366 Score = 62.4 bits (150), Expect = 4e-08 Identities = 23/39 (58%), Positives = 34/39 (87%) Frame = +2 Query: 134 IKRLTPVQMRARREKGLCYNCDDQYKPGHHCKSQQLYML 250 ++RL+P QM+ RR+KGLCYNCDD++ PGH CKS +L+++ Sbjct: 241 VQRLSPSQMKERRDKGLCYNCDDKWAPGHKCKSXRLFIM 279 >emb|CAN66607.1| hypothetical protein VITISV_017554 [Vitis vinifera] Length = 2822 Score = 62.4 bits (150), Expect = 4e-08 Identities = 23/39 (58%), Positives = 34/39 (87%) Frame = +2 Query: 134 IKRLTPVQMRARREKGLCYNCDDQYKPGHHCKSQQLYML 250 ++RL+P QM+ RR+KGLCYNCDD++ PGH CKS +L+++ Sbjct: 239 VQRLSPSQMKERRDKGLCYNCDDKWAPGHKCKSARLFIM 277 >emb|CAN76793.1| hypothetical protein VITISV_026680 [Vitis vinifera] Length = 1469 Score = 62.4 bits (150), Expect = 4e-08 Identities = 23/39 (58%), Positives = 34/39 (87%) Frame = +2 Query: 134 IKRLTPVQMRARREKGLCYNCDDQYKPGHHCKSQQLYML 250 ++RL+P QM+ RR+KGLCYNCDD++ PGH CKS +L+++ Sbjct: 274 VQRLSPSQMKERRDKGLCYNCDDKWAPGHKCKSARLFIM 312 >emb|CAN76938.1| hypothetical protein VITISV_025425 [Vitis vinifera] Length = 446 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/71 (36%), Positives = 47/71 (66%), Gaps = 5/71 (7%) Frame = +2 Query: 32 LQKLQFHPTRTPNNISLSNLQVLNYNKSTTTVPL-----IKRLTPVQMRARREKGLCYNC 196 L ++++H ++ +L + ++ N + T+ PL I+RL+P +M+ RR+KGLC+NC Sbjct: 303 LYEVKYHKR---SSFNLEPKKTVSTNSTVTSRPLSSTPAIRRLSPTEMKERRDKGLCFNC 359 Query: 197 DDQYKPGHHCK 229 D+++ PGH CK Sbjct: 360 DEKFAPGHRCK 370 >ref|XP_004160268.1| PREDICTED: uncharacterized protein LOC101232747 [Cucumis sativus] Length = 701 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/62 (45%), Positives = 38/62 (61%) Frame = +2 Query: 53 PTRTPNNISLSNLQVLNYNKSTTTVPLIKRLTPVQMRARREKGLCYNCDDQYKPGHHCKS 232 P R+ NN S LQ N K P IKRL+ + RAR +KGLC+ C+++Y PGH CK Sbjct: 191 PKRSENN---SKLQGKNEKKKD---PPIKRLSDTEFRARLDKGLCFRCNEKYSPGHRCKG 244 Query: 233 QQ 238 ++ Sbjct: 245 RE 246