BLASTX nr result
ID: Coptis24_contig00019770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00019770 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285718.1| PREDICTED: purine permease 3 [Vitis vinifera] 66 3e-09 ref|XP_002285717.1| PREDICTED: purine permease 3 [Vitis vinifera... 64 1e-08 gb|AAF64547.1|AF078531_1 purine permease [Arabidopsis thaliana] 61 1e-07 ref|NP_174144.1| purine permease 1 [Arabidopsis thaliana] gi|751... 61 1e-07 ref|XP_002285719.1| PREDICTED: purine permease 3-like [Vitis vin... 61 1e-07 >ref|XP_002285718.1| PREDICTED: purine permease 3 [Vitis vinifera] Length = 351 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -2 Query: 266 FHERFNAEKGMSLALSLWGFVSYFYGEYNLIKKQKQAPPMTQIP 135 FH++F AEKG+SLALSLWGFVSYFYGE KK+K P T++P Sbjct: 303 FHDKFQAEKGVSLALSLWGFVSYFYGEIKDSKKKKNPTPETELP 346 >ref|XP_002285717.1| PREDICTED: purine permease 3 [Vitis vinifera] gi|147816930|emb|CAN64392.1| hypothetical protein VITISV_015235 [Vitis vinifera] Length = 349 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -2 Query: 266 FHERFNAEKGMSLALSLWGFVSYFYGEYNLIKKQKQAPPMTQIP 135 F E+F AEKG+SLALSLWGFVSYFYGE KK+K P T++P Sbjct: 301 FQEKFQAEKGVSLALSLWGFVSYFYGEIKDSKKKKNPTPETELP 344 >gb|AAF64547.1|AF078531_1 purine permease [Arabidopsis thaliana] Length = 356 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/46 (63%), Positives = 34/46 (73%), Gaps = 2/46 (4%) Frame = -2 Query: 266 FHERFNAEKGMSLALSLWGFVSYFYGEYNLIKK--QKQAPPMTQIP 135 F E+F AEKG+SL LSLWGFVSYFYGE+ KK K PP T++P Sbjct: 302 FREKFQAEKGVSLLLSLWGFVSYFYGEFKSGKKVVDKPQPPETELP 347 >ref|NP_174144.1| purine permease 1 [Arabidopsis thaliana] gi|75173386|sp|Q9FZ96.1|PUP1_ARATH RecName: Full=Purine permease 1; Short=AtPUP1 gi|9795614|gb|AAF98432.1|AC021044_11 purine permease [Arabidopsis thaliana] gi|26450405|dbj|BAC42317.1| putative purine permease [Arabidopsis thaliana] gi|28973199|gb|AAO63924.1| putative purine permease [Arabidopsis thaliana] gi|332192813|gb|AEE30934.1| purine permease 1 [Arabidopsis thaliana] Length = 356 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/46 (63%), Positives = 34/46 (73%), Gaps = 2/46 (4%) Frame = -2 Query: 266 FHERFNAEKGMSLALSLWGFVSYFYGEYNLIKK--QKQAPPMTQIP 135 F E+F AEKG+SL LSLWGFVSYFYGE+ KK K PP T++P Sbjct: 302 FREKFQAEKGVSLLLSLWGFVSYFYGEFKSGKKVVDKPQPPETELP 347 >ref|XP_002285719.1| PREDICTED: purine permease 3-like [Vitis vinifera] Length = 351 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 266 FHERFNAEKGMSLALSLWGFVSYFYGEYNLIKKQKQAPPMTQIP 135 F E+F AEKG+SLALSLWGFVSYFYGE KK+K T++P Sbjct: 303 FREKFQAEKGVSLALSLWGFVSYFYGEIKDSKKKKNPTSETELP 346