BLASTX nr result
ID: Coptis24_contig00019689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00019689 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279957.2| PREDICTED: uncharacterized protein LOC100259... 75 7e-12 ref|XP_002510535.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 >ref|XP_002279957.2| PREDICTED: uncharacterized protein LOC100259217 [Vitis vinifera] gi|302142661|emb|CBI19864.3| unnamed protein product [Vitis vinifera] Length = 379 Score = 74.7 bits (182), Expect = 7e-12 Identities = 48/119 (40%), Positives = 61/119 (51%), Gaps = 8/119 (6%) Frame = +1 Query: 1 EAETDISCREISRLXXXXXXXXXXXXAPLTPDLGCSTTGASTRG-------MERRISSRN 159 E ET EISRL A +TP L T T G + R IS + Sbjct: 257 ETETKKKNEEISRLSKEVELLRKSRSASVTPILNRCTEKQKTSGQGKNKSWIGRNISIKK 316 Query: 160 GRPVLTKGSPRSQGSGI-EKKPDIKERGSKRKEVKTIPSSDTPRLFSSTFKVPKLKNLS 333 P K + + + S + EK + K RGSKRKE+ P+S+TPRLF+STFK+PKLKN S Sbjct: 317 ETPASEKNTEKKKESSVSEKNTEKKSRGSKRKEINVTPTSETPRLFTSTFKIPKLKNSS 375 >ref|XP_002510535.1| conserved hypothetical protein [Ricinus communis] gi|223551236|gb|EEF52722.1| conserved hypothetical protein [Ricinus communis] Length = 354 Score = 61.2 bits (147), Expect = 8e-08 Identities = 46/119 (38%), Positives = 58/119 (48%), Gaps = 4/119 (3%) Frame = +1 Query: 1 EAETDISCREISRLXXXXXXXXXXXXAPLTPDLGCSTTGASTRGMERRISSRNGRP---- 168 E + D E SRL A +TP L TGA R+ NGR Sbjct: 239 EVDRDKWKEENSRLLQELELLKKSRSAQVTPSLKHCNTGAKASS---RVVKSNGRSRSNV 295 Query: 169 VLTKGSPRSQGSGIEKKPDIKERGSKRKEVKTIPSSDTPRLFSSTFKVPKLKNLSLPTT 345 V+ K ++ + K D RGSKRKEV+TI +TP+LFS++FKVPKLK S P T Sbjct: 296 VVKKELCPAKAAPPLKDADKGSRGSKRKEVETITILETPKLFSASFKVPKLKISSTPVT 354