BLASTX nr result
ID: Coptis24_contig00019355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00019355 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278820.1| PREDICTED: 50S ribosomal protein L5, chlorop... 67 2e-09 >ref|XP_002278820.1| PREDICTED: 50S ribosomal protein L5, chloroplastic [Vitis vinifera] gi|297745362|emb|CBI40442.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 66.6 bits (161), Expect = 2e-09 Identities = 37/56 (66%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = +3 Query: 60 MASSATLHSCFSSFHGQSPILSSPISTRFPTPSSRNQCGFSVKA-SNVVLVEKSEA 224 MAS A L S SSFHGQ P+ SSP S R P + RN CGFSVKA S +VLVEKSEA Sbjct: 1 MASPALLQSNASSFHGQFPLASSPFSVRLPYGNPRNGCGFSVKALSEIVLVEKSEA 56