BLASTX nr result
ID: Coptis24_contig00019312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00019312 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136798.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 ref|XP_002272104.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_004136798.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Cucumis sativus] gi|449494815|ref|XP_004159654.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Cucumis sativus] Length = 405 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/74 (41%), Positives = 49/74 (66%) Frame = +2 Query: 56 PPTQYRKSKTLIRNETDPDKIAQVFLKTSDNPRFYRDRSAFHISVRKLAKLQRFDLVEKI 235 P R +K+ I +++DPDK+AQ F++ S P F R R +H S+RKLA+ QRFDL++ I Sbjct: 36 PFPSLRAAKSAILSQSDPDKLAQSFIQASTLPSFCRYRPIYHQSIRKLARAQRFDLIDVI 95 Query: 236 LEQQIETPLLKTEG 277 ++ ++P +EG Sbjct: 96 IQSHHKSPSATSEG 109 >ref|XP_002272104.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Vitis vinifera] gi|297738261|emb|CBI27462.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 1/75 (1%) Frame = +2 Query: 56 PPTQYRKSKTLIRNETDPDKIAQVFLKTSDN-PRFYRDRSAFHISVRKLAKLQRFDLVEK 232 P T + +K+ + +E DP+K+A +F S N RF R R + +S R+L++ R DLVE+ Sbjct: 23 PFTTFLAAKSAVESEPDPEKLAHIFHHQSSNFARFRRHRPLYQLSCRRLSRSGRLDLVER 82 Query: 233 ILEQQIETPLLKTEG 277 +++ Q P +TEG Sbjct: 83 LIDHQKTLPHPRTEG 97