BLASTX nr result
ID: Coptis24_contig00019094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00019094 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65190.1| hypothetical protein VITISV_032101 [Vitis vinifera] 64 1e-08 ref|XP_002266998.1| PREDICTED: RNA polymerase II transcriptional... 64 1e-08 emb|CBI34506.3| unnamed protein product [Vitis vinifera] 64 1e-08 dbj|BAB41214.1| putative transcriptional coactivator [Brassica r... 55 6e-06 >emb|CAN65190.1| hypothetical protein VITISV_032101 [Vitis vinifera] Length = 320 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/47 (61%), Positives = 40/47 (85%) Frame = +1 Query: 85 EMEPEMETQITETVISILKNSDMNEMTEFKVRKMAGDKLGFDLSSPE 225 +MEPE +I +TV+ ILK++DM+EMTEFKVRK+A DKLG +LS+P+ Sbjct: 78 KMEPETRRRIEKTVLEILKSADMDEMTEFKVRKLASDKLGINLSAPD 124 >ref|XP_002266998.1| PREDICTED: RNA polymerase II transcriptional coactivator KELP-like [Vitis vinifera] Length = 187 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = +1 Query: 88 MEPEMETQITETVISILKNSDMNEMTEFKVRKMAGDKLGFDLSSPE 225 MEPE +I +TV+ ILK++DM+EMTEFKVRK+A DKLG +LS+P+ Sbjct: 1 MEPETRRRIEKTVLEILKSADMDEMTEFKVRKLASDKLGINLSAPD 46 >emb|CBI34506.3| unnamed protein product [Vitis vinifera] Length = 142 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = +1 Query: 88 MEPEMETQITETVISILKNSDMNEMTEFKVRKMAGDKLGFDLSSPE 225 MEPE +I +TV+ ILK++DM+EMTEFKVRK+A DKLG +LS+P+ Sbjct: 1 MEPETRRRIEKTVLEILKSADMDEMTEFKVRKLASDKLGINLSAPD 46 >dbj|BAB41214.1| putative transcriptional coactivator [Brassica rapa] Length = 165 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +1 Query: 88 MEPEMETQITETVISILKNSDMNEMTEFKVRKMAGDKLGFDLS 216 ME E + +I ETV ILK SDM EMTEFKVR +A ++LG DLS Sbjct: 1 MEEESKAKIEETVREILKESDMTEMTEFKVRNLASERLGIDLS 43