BLASTX nr result
ID: Coptis24_contig00018974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00018974 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24131.3| unnamed protein product [Vitis vinifera] 121 5e-26 ref|XP_002265699.1| PREDICTED: general transcription factor 3C p... 121 5e-26 ref|XP_003540640.1| PREDICTED: general transcription factor 3C p... 120 1e-25 ref|XP_003538968.1| PREDICTED: general transcription factor 3C p... 120 2e-25 ref|XP_003607543.1| Transcription factor tau subunit sfc4 [Medic... 119 3e-25 >emb|CBI24131.3| unnamed protein product [Vitis vinifera] Length = 915 Score = 121 bits (304), Expect = 5e-26 Identities = 54/81 (66%), Positives = 69/81 (85%) Frame = -1 Query: 428 ARAYQHVGLVTLAASYYEKVIATQVKGYPIPKMPIEDSSLPQSHSQGYCNLRREAVYNLH 249 ARAY HVGLV+LA +YYEKV+AT + YPIP++P E++ L ++ GYC+LRREA YNLH Sbjct: 834 ARAYHHVGLVSLAVTYYEKVLATHERDYPIPRLPYENTDLVENRKPGYCDLRREAAYNLH 893 Query: 248 LIYRKSGALDLARQVLRNHCS 186 LIY+KSGALDLARQVL++HC+ Sbjct: 894 LIYKKSGALDLARQVLKDHCT 914 >ref|XP_002265699.1| PREDICTED: general transcription factor 3C polypeptide 3-like [Vitis vinifera] Length = 1110 Score = 121 bits (304), Expect = 5e-26 Identities = 54/81 (66%), Positives = 69/81 (85%) Frame = -1 Query: 428 ARAYQHVGLVTLAASYYEKVIATQVKGYPIPKMPIEDSSLPQSHSQGYCNLRREAVYNLH 249 ARAY HVGLV+LA +YYEKV+AT + YPIP++P E++ L ++ GYC+LRREA YNLH Sbjct: 1029 ARAYHHVGLVSLAVTYYEKVLATHERDYPIPRLPYENTDLVENRKPGYCDLRREAAYNLH 1088 Query: 248 LIYRKSGALDLARQVLRNHCS 186 LIY+KSGALDLARQVL++HC+ Sbjct: 1089 LIYKKSGALDLARQVLKDHCT 1109 >ref|XP_003540640.1| PREDICTED: general transcription factor 3C polypeptide 3-like [Glycine max] Length = 919 Score = 120 bits (301), Expect = 1e-25 Identities = 57/81 (70%), Positives = 67/81 (82%) Frame = -1 Query: 428 ARAYQHVGLVTLAASYYEKVIATQVKGYPIPKMPIEDSSLPQSHSQGYCNLRREAVYNLH 249 ARA+ HVGLVTLAA YYEKVIA K YPIPK+P E+ ++H GYC+LRREA YNLH Sbjct: 838 ARAFHHVGLVTLAAFYYEKVIAICEKDYPIPKLPNENPDSIETHKPGYCDLRREAAYNLH 897 Query: 248 LIYRKSGALDLARQVLRNHCS 186 LIY+KSGALDLARQVL++HC+ Sbjct: 898 LIYKKSGALDLARQVLKDHCT 918 >ref|XP_003538968.1| PREDICTED: general transcription factor 3C polypeptide 3-like [Glycine max] Length = 929 Score = 120 bits (300), Expect = 2e-25 Identities = 56/81 (69%), Positives = 68/81 (83%) Frame = -1 Query: 428 ARAYQHVGLVTLAASYYEKVIATQVKGYPIPKMPIEDSSLPQSHSQGYCNLRREAVYNLH 249 ARA+ HVGLVTLA YYEKVIA + YPIPK+P E+S + ++H GYC+LRREA YNLH Sbjct: 848 ARAFHHVGLVTLAVIYYEKVIAMCERDYPIPKLPNENSDIIETHKPGYCDLRREAAYNLH 907 Query: 248 LIYRKSGALDLARQVLRNHCS 186 LIY+KSGALDLARQVLR++C+ Sbjct: 908 LIYKKSGALDLARQVLRDYCT 928 >ref|XP_003607543.1| Transcription factor tau subunit sfc4 [Medicago truncatula] gi|355508598|gb|AES89740.1| Transcription factor tau subunit sfc4 [Medicago truncatula] Length = 937 Score = 119 bits (298), Expect = 3e-25 Identities = 56/81 (69%), Positives = 67/81 (82%) Frame = -1 Query: 428 ARAYQHVGLVTLAASYYEKVIATQVKGYPIPKMPIEDSSLPQSHSQGYCNLRREAVYNLH 249 ARAY HVGLVTLAA YYEKVIA + + YPIPK+ E + ++H GYCNLRREA YNLH Sbjct: 856 ARAYHHVGLVTLAAIYYEKVIAIRERDYPIPKLQNESIDVIENHKPGYCNLRREAAYNLH 915 Query: 248 LIYRKSGALDLARQVLRNHCS 186 LIY++SGALDLARQVL+++CS Sbjct: 916 LIYKRSGALDLARQVLKDYCS 936