BLASTX nr result
ID: Coptis24_contig00018611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00018611 (190 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526170.1| pentatricopeptide repeat-containing protein,... 70 2e-10 gb|AAM52339.1| fertility restorer [Petunia x hybrida] 68 9e-10 ref|XP_003633275.1| PREDICTED: putative pentatricopeptide repeat... 65 4e-09 ref|XP_003623405.1| Pentatricopeptide repeat-containing protein ... 65 4e-09 gb|AAM52341.1| fertility restorer-like protein [Petunia x hybrida] 65 6e-09 >ref|XP_002526170.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534547|gb|EEF36246.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 504 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/63 (44%), Positives = 47/63 (74%) Frame = -1 Query: 190 LPNTITYTAMINGFCQEGMLIDAQSLFIEMEENSVAPNDRTFNIMVQGFLKGRNFEKAVQ 11 +PN +TY MING C+EG L++A+ LF++MEE+ ++ +FN +++GFL+ +KA++ Sbjct: 391 VPNIVTYNIMINGLCKEGKLLEAERLFVQMEESGCEQDEISFNFIIRGFLQENQVQKAME 450 Query: 10 FLK 2 FLK Sbjct: 451 FLK 453 >gb|AAM52339.1| fertility restorer [Petunia x hybrida] Length = 592 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/62 (45%), Positives = 45/62 (72%) Frame = -1 Query: 187 PNTITYTAMINGFCQEGMLIDAQSLFIEMEENSVAPNDRTFNIMVQGFLKGRNFEKAVQF 8 P+ ITYTAMI+G+CQEG+L +A+ + +ME+N P++RT+N++V+GF + + F Sbjct: 491 PDVITYTAMISGYCQEGLLDEAKDMLRKMEDNGCLPDNRTYNVIVRGFFRSSKVSEMKAF 550 Query: 7 LK 2 LK Sbjct: 551 LK 552 >ref|XP_003633275.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Vitis vinifera] Length = 572 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/62 (45%), Positives = 42/62 (67%) Frame = -1 Query: 187 PNTITYTAMINGFCQEGMLIDAQSLFIEMEENSVAPNDRTFNIMVQGFLKGRNFEKAVQF 8 P+ TYT MING CQ+G+L +A LF EM+EN +PN T+N++ +GFL+ +A+Q Sbjct: 472 PDVRTYTIMINGLCQQGLLAEASKLFGEMDENGCSPNACTYNLITRGFLRNNETLRAIQL 531 Query: 7 LK 2 + Sbjct: 532 FQ 533 >ref|XP_003623405.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498420|gb|AES79623.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 737 Score = 65.5 bits (158), Expect = 4e-09 Identities = 25/61 (40%), Positives = 43/61 (70%) Frame = -1 Query: 187 PNTITYTAMINGFCQEGMLIDAQSLFIEMEENSVAPNDRTFNIMVQGFLKGRNFEKAVQF 8 PN ++YT +ING+C G + DA +F EM E+ + PN T++++++GFL+GR+FE + Sbjct: 143 PNVVSYTTLINGYCSVGGIRDAMKVFDEMLESGLEPNSMTYSVLIRGFLRGRDFESGREL 202 Query: 7 L 5 + Sbjct: 203 M 203 >gb|AAM52341.1| fertility restorer-like protein [Petunia x hybrida] Length = 592 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/62 (43%), Positives = 45/62 (72%) Frame = -1 Query: 187 PNTITYTAMINGFCQEGMLIDAQSLFIEMEENSVAPNDRTFNIMVQGFLKGRNFEKAVQF 8 P+ ITYTAMI+G+CQEG+L +A+ + +ME+N ++RT+N++V+GFL+ + F Sbjct: 491 PDVITYTAMISGYCQEGLLDEAKDMLRKMEDNGCLADNRTYNVIVRGFLRSNKVSEMKAF 550 Query: 7 LK 2 L+ Sbjct: 551 LE 552