BLASTX nr result
ID: Coptis24_contig00018521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00018521 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284696.1| PREDICTED: random slug protein 5 [Vitis vini... 59 3e-07 ref|NP_171669.1| protein sec fourteen-like protein-20 [Arabidops... 59 4e-07 ref|XP_002892050.1| hypothetical protein ARALYDRAFT_470113 [Arab... 59 4e-07 gb|AAL86320.1| putative polyphosphoinositide binding protein [Ar... 59 4e-07 ref|XP_004152162.1| PREDICTED: random slug protein 5-like [Cucum... 59 5e-07 >ref|XP_002284696.1| PREDICTED: random slug protein 5 [Vitis vinifera] gi|147860850|emb|CAN83160.1| hypothetical protein VITISV_022555 [Vitis vinifera] gi|297734520|emb|CBI15767.3| unnamed protein product [Vitis vinifera] Length = 256 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -1 Query: 227 DKNTSKKIAFVEKKKMTSILLQDIDKSQLPQVYGGHLQLVLVENA 93 DKNT KKI VEK K+ S LL++ID+SQLPQ+YGG L LV ++++ Sbjct: 212 DKNTKKKIVLVEKTKLRSTLLEEIDESQLPQIYGGKLPLVPIQDS 256 >ref|NP_171669.1| protein sec fourteen-like protein-20 [Arabidopsis thaliana] gi|8671832|gb|AAF78395.1|AC009273_1 Strong similarity to polyphosphoinositide binding protein Ssh2 from soybean gb|AF024652. It contains a CRAL/TRIO domain PF|00650. EST gb|AI995792 comes from this gene [Arabidopsis thaliana] gi|21554088|gb|AAM63169.1| polyphosphoinositide binding protein, putative [Arabidopsis thaliana] gi|23297520|gb|AAN12987.1| putative polyphosphoinositide-binding protein [Arabidopsis thaliana] gi|332189193|gb|AEE27314.1| protein sec fourteen-like protein-20 [Arabidopsis thaliana] Length = 255 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -1 Query: 227 DKNTSKKIAFVEKKKMTSILLQDIDKSQLPQVYGGHLQLVLVE 99 D NT KKI FVE KK+T LL+DID+SQLP +YGG L LV ++ Sbjct: 211 DANTKKKIVFVENKKLTPTLLEDIDESQLPDIYGGKLPLVPIQ 253 >ref|XP_002892050.1| hypothetical protein ARALYDRAFT_470113 [Arabidopsis lyrata subsp. lyrata] gi|297337892|gb|EFH68309.1| hypothetical protein ARALYDRAFT_470113 [Arabidopsis lyrata subsp. lyrata] Length = 256 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -1 Query: 227 DKNTSKKIAFVEKKKMTSILLQDIDKSQLPQVYGGHLQLVLVE 99 D NT KKI FVE KK+T LL+DID+SQLP +YGG L LV ++ Sbjct: 212 DANTKKKIVFVENKKLTPTLLEDIDESQLPDIYGGKLPLVPIQ 254 >gb|AAL86320.1| putative polyphosphoinositide binding protein [Arabidopsis thaliana] Length = 192 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -1 Query: 227 DKNTSKKIAFVEKKKMTSILLQDIDKSQLPQVYGGHLQLVLVE 99 D NT KKI FVE KK+T LL+DID+SQLP +YGG L LV ++ Sbjct: 148 DANTKKKIVFVENKKLTPTLLEDIDESQLPDIYGGKLPLVPIQ 190 >ref|XP_004152162.1| PREDICTED: random slug protein 5-like [Cucumis sativus] gi|449484780|ref|XP_004156977.1| PREDICTED: random slug protein 5-like [Cucumis sativus] Length = 284 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -1 Query: 227 DKNTSKKIAFVEKKKMTSILLQDIDKSQLPQVYGGHLQLVLVEN 96 DK T KKI FVE KK+ S LL DID+SQLP VYGG L LV +++ Sbjct: 240 DKKTKKKICFVEDKKLRSTLLNDIDESQLPDVYGGKLSLVPIQD 283