BLASTX nr result
ID: Coptis24_contig00017914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00017914 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_08200493.1| hypothetical protein NBCG_05699 [Nocardioidac... 90 2e-16 ref|ZP_06706815.1| hypothetical protein SSTG_00255 [Streptomyces... 88 8e-16 ref|ZP_09369757.1| hypothetical protein HMPREF0975_01540 [Actino... 85 5e-15 ref|ZP_07286019.1| conserved hypothetical protein [Streptomyces ... 84 9e-15 ref|ZP_06710336.1| hypothetical protein SSTG_03777 [Streptomyces... 84 2e-14 >ref|ZP_08200493.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] gi|325947935|gb|EGD40054.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] Length = 86 Score = 90.1 bits (222), Expect = 2e-16 Identities = 45/67 (67%), Positives = 52/67 (77%) Frame = +1 Query: 34 MWPVTLSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQ 213 MWPVTLSGRLPV+ALVSHY TNKLI RE IP R+ F MQ+ ++SGI+ F LSQS Sbjct: 1 MWPVTLSGRLPVEALVSHYLTNKLIGREHIPGRKTFHNHPMQEVVVSGINHRFRWLSQSL 60 Query: 214 GQVTHVL 234 GQ+THVL Sbjct: 61 GQITHVL 67 >ref|ZP_06706815.1| hypothetical protein SSTG_00255 [Streptomyces sp. e14] gi|292831588|gb|EFF89937.1| hypothetical protein SSTG_00255 [Streptomyces sp. e14] Length = 86 Score = 87.8 bits (216), Expect = 8e-16 Identities = 44/67 (65%), Positives = 50/67 (74%) Frame = +1 Query: 34 MWPVTLSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQ 213 MWPV LSGRLPV ALVSHY TNKLI R I +RR+FP M + L+SGI P F LSQS+ Sbjct: 1 MWPVALSGRLPVVALVSHYLTNKLIGRGLILHRRSFPASKMPRRLVSGIRPRFQGLSQSE 60 Query: 214 GQVTHVL 234 GQ+ HVL Sbjct: 61 GQIAHVL 67 >ref|ZP_09369757.1| hypothetical protein HMPREF0975_01540 [Actinomyces sp. oral taxon 849 str. F0330] gi|365264633|gb|EHM94433.1| hypothetical protein HMPREF0975_01540 [Actinomyces sp. oral taxon 849 str. F0330] Length = 255 Score = 85.1 bits (209), Expect = 5e-15 Identities = 42/72 (58%), Positives = 53/72 (73%), Gaps = 5/72 (6%) Frame = +1 Query: 34 MWPVTLSGRLPVKALVSHYPTNKLISRESIPNRR-----NFPTPTMQQELLSGISPSFLK 198 MWP TLSGRLPV ALV H+PTNKLI RE IP+R+ +FP P + + ISP+F++ Sbjct: 1 MWPSTLSGRLPVTALVGHHPTNKLIGREPIPHRKHPKAQSFPNPPCDRPGIPRISPTFMR 60 Query: 199 LSQSQGQVTHVL 234 LS+ +GQVTHVL Sbjct: 61 LSRRRGQVTHVL 72 >ref|ZP_07286019.1| conserved hypothetical protein [Streptomyces sp. C] gi|302442572|gb|EFL14388.1| conserved hypothetical protein [Streptomyces sp. C] Length = 84 Score = 84.3 bits (207), Expect = 9e-15 Identities = 43/65 (66%), Positives = 48/65 (73%) Frame = +1 Query: 40 PVTLSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQGQ 219 PV LSGRLPV ALV HYPTNKLI R I +RR+F P MQ +LSGI P F LSQS+GQ Sbjct: 1 PVALSGRLPVVALVGHYPTNKLIGRGLILHRRSFQLPPMQAGVLSGIRPRFQGLSQSEGQ 60 Query: 220 VTHVL 234 + HVL Sbjct: 61 IAHVL 65 >ref|ZP_06710336.1| hypothetical protein SSTG_03777 [Streptomyces sp. e14] gi|292835109|gb|EFF93458.1| hypothetical protein SSTG_03777 [Streptomyces sp. e14] Length = 86 Score = 83.6 bits (205), Expect = 2e-14 Identities = 43/67 (64%), Positives = 48/67 (71%) Frame = +1 Query: 34 MWPVTLSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQ 213 MWPV LSGRLPV ALVS Y TNKLI R I +RR+FP M L+SGI P F LSQS+ Sbjct: 1 MWPVALSGRLPVVALVSRYLTNKLIGRGLILHRRSFPASKMPWRLVSGIRPRFQGLSQSE 60 Query: 214 GQVTHVL 234 GQ+ HVL Sbjct: 61 GQIAHVL 67