BLASTX nr result
ID: Coptis24_contig00017796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00017796 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635207.1| PREDICTED: uncharacterized protein LOC100853... 60 2e-07 ref|XP_002521422.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|XP_003635208.1| PREDICTED: uncharacterized protein LOC100853... 55 8e-06 >ref|XP_003635207.1| PREDICTED: uncharacterized protein LOC100853563 [Vitis vinifera] Length = 60 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +3 Query: 33 MAGARRMMKVNNAN-GQRVSGRPIPKRGQVKAGIAIGLAHSLSAIF 167 MAG RR M +N N QR SGRPIPKRGQVK GI +GLAHS+++IF Sbjct: 1 MAGGRRAM-INGGNFSQRFSGRPIPKRGQVKVGIVVGLAHSVASIF 45 >ref|XP_002521422.1| conserved hypothetical protein [Ricinus communis] gi|223539321|gb|EEF40912.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 55.8 bits (133), Expect = 3e-06 Identities = 32/68 (47%), Positives = 39/68 (57%) Frame = +3 Query: 33 MAGARRMMKVNNANGQRVSGRPIPKRGQVKAGIAIGLAHSLSAIFXXXXXXXXXXXXXMA 212 M AR M + +R+SGRPIPKRGQVK GI +GLAHS+++IF A Sbjct: 1 MEWARMGMMSDRKVSRRLSGRPIPKRGQVKVGIVVGLAHSVASIF------SHSHSSRRA 54 Query: 213 QPTRIHFS 236 PT HFS Sbjct: 55 APTASHFS 62 >ref|XP_003635208.1| PREDICTED: uncharacterized protein LOC100853596 [Vitis vinifera] Length = 60 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +3 Query: 33 MAGARRMMKVNNANGQRVSGRPIPKRGQVKAGIAIGLAHSLSAIF 167 MAG R M + QR SGRPIPKRGQVK IA+G AHS+++IF Sbjct: 1 MAGGRGDMINGGSFSQRFSGRPIPKRGQVKVAIAVGFAHSVASIF 45