BLASTX nr result
ID: Coptis24_contig00017172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00017172 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554592.1| PREDICTED: translation initiation factor IF-... 73 2e-11 ref|XP_002509907.1| mitochondrial translational initiation facto... 73 2e-11 ref|XP_003521638.1| PREDICTED: translation initiation factor IF-... 72 5e-11 ref|XP_002297989.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_003613053.1| Translation initiation factor IF-2 [Medicago... 71 1e-10 >ref|XP_003554592.1| PREDICTED: translation initiation factor IF-2-like [Glycine max] Length = 718 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 205 ITSFLVFVNIVHVGVGIISQSDVDLAQACGACIVGFNIRSPPNS 336 + S VFVN+VHVG G ISQSDVDLAQACGACIVGFN++SPP + Sbjct: 521 LNSAQVFVNVVHVGAGPISQSDVDLAQACGACIVGFNVKSPPTA 564 >ref|XP_002509907.1| mitochondrial translational initiation factor, putative [Ricinus communis] gi|223549806|gb|EEF51294.1| mitochondrial translational initiation factor, putative [Ricinus communis] Length = 458 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +1 Query: 220 VFVNIVHVGVGIISQSDVDLAQACGACIVGFNIRSPPNS 336 VFVN+VHVGVG ISQSDVDLAQACGACIVGFN+++PP++ Sbjct: 265 VFVNVVHVGVGPISQSDVDLAQACGACIVGFNVKTPPSA 303 >ref|XP_003521638.1| PREDICTED: translation initiation factor IF-2-like [Glycine max] Length = 718 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +1 Query: 205 ITSFLVFVNIVHVGVGIISQSDVDLAQACGACIVGFNIRSPPNS 336 + S VFVN+VHVG G ISQSD+DLAQACGACIVGFN++SPP + Sbjct: 521 LNSAQVFVNVVHVGAGPISQSDLDLAQACGACIVGFNVKSPPTA 564 >ref|XP_002297989.1| predicted protein [Populus trichocarpa] gi|222845247|gb|EEE82794.1| predicted protein [Populus trichocarpa] Length = 588 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 220 VFVNIVHVGVGIISQSDVDLAQACGACIVGFNIRSPPNS 336 VFVN+VHVGVG ISQSDVDLAQACGA IVGFN++SPP+S Sbjct: 395 VFVNVVHVGVGPISQSDVDLAQACGAYIVGFNVKSPPSS 433 >ref|XP_003613053.1| Translation initiation factor IF-2 [Medicago truncatula] gi|355514388|gb|AES96011.1| Translation initiation factor IF-2 [Medicago truncatula] Length = 749 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +1 Query: 220 VFVNIVHVGVGIISQSDVDLAQACGACIVGFNIRSPPNS 336 V VN+VHVGVG ISQSDVDLAQACGACIVGFN++SPP S Sbjct: 479 VSVNVVHVGVGPISQSDVDLAQACGACIVGFNVKSPPIS 517